Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 1 showing 1 ~ 20 out of 620 results
Snippet view Table view Download 620 Result(s)
Click the to add this resource to a Collection
  • RRID:Addgene_161793

    This resource has 1+ mentions.

http://www.addgene.org/161793

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36619904
Comments: The SARS-CoV-2 RBD insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]). This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 RBD protein. This protein can be recovered from the cell culture medium by His-tag purification. The recombinant RBD is suitable for COVID-19 serology testing and monitoring of humoral responses in vaccinated population.

Proper citation: RRID:Addgene_161793 Copy   


http://www.addgene.org/162817

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF6
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2)

Proper citation: RRID:Addgene_162817 Copy   


http://www.addgene.org/162816

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_9b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2)

Proper citation: RRID:Addgene_162816 Copy   


http://www.addgene.org/162821

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF3b_alt
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP

Proper citation: RRID:Addgene_162821 Copy   


http://www.addgene.org/170190

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33248226
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170190 Copy   


http://www.addgene.org/170191

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33248226
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170191 Copy   


http://www.addgene.org/170194

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33248226
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170194 Copy   


http://www.addgene.org/170202

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33248226
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170202 Copy   


http://www.addgene.org/170203

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33248226
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170203 Copy   


http://www.addgene.org/170200

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S (spike) B.1.429
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32504802
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170200 Copy   


http://www.addgene.org/170201

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S (spike) D614G
Vector Backbone Description: Vector Backbone:pDest-303; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32504802
Comments: DNA sequence optimized for mammalian expression

Proper citation: RRID:Addgene_170201 Copy   


http://www.addgene.org/170389

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Spike
Vector Backbone Description: Backbone Size:4971; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33969320

Proper citation: RRID:Addgene_170389 Copy   


http://www.addgene.org/170466

Species: SARS-CoV-2
Genetic Insert: Nucleocapsid
Vector Backbone Description: Vector Backbone:pHAGE; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.09.10.459410v2 for bioRxiv preprint.

Proper citation: RRID:Addgene_170466 Copy   


http://www.addgene.org/176057

Species: SARS-CoV-2
Genetic Insert: CoV-2 nsp1
Vector Backbone Description: Backbone Size:5163; Vector Backbone:pCDNA4TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34624207

Proper citation: RRID:Addgene_176057 Copy   


http://www.addgene.org/176059

Species: SARS-CoV-2
Genetic Insert: CoV-2 nsp1 R124A/K125A
Vector Backbone Description: Backbone Size:5163; Vector Backbone:pCDNA4TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34624207

Proper citation: RRID:Addgene_176059 Copy   


http://www.addgene.org/176061

Species: SARS-CoV-2
Genetic Insert: CoV-2 nsp1
Vector Backbone Description: Backbone Size:5163; Vector Backbone:pCDNA4TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34624207

Proper citation: RRID:Addgene_176061 Copy   


http://www.addgene.org/176060

Species: SARS-CoV-2
Genetic Insert: CoV-2 K164A H165A nsp1
Vector Backbone Description: Backbone Size:5163; Vector Backbone:pCDNA4TO; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34624207

Proper citation: RRID:Addgene_176060 Copy   


http://www.addgene.org/141367

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2-nsp1
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:8825; Vector Backbone:pLVX-EF1alpha-IRES-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32353859
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.03.22.002386v3 for bioRxiv preprint.

Proper citation: RRID:Addgene_141367 Copy   


http://www.addgene.org/141369

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2-nsp4
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:8825; Vector Backbone:pLVX-EF1alpha-IRES-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32353859
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.03.22.002386v3 for bioRxiv preprint.

Proper citation: RRID:Addgene_141369 Copy   


http://www.addgene.org/141376

Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2-nsp10
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:8825; Vector Backbone:pLVX-EF1alpha-IRES-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32353859
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.03.22.002386v3 for bioRxiv preprint.

Proper citation: RRID:Addgene_141376 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. SPARC Anatomical Working Group Resources

    Welcome to the SPARC SAWG Resources search. From here you can search through a compilation of resources used by SPARC SAWG and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that SPARC SAWG has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on SPARC SAWG then you can log in from here to get additional features in SPARC SAWG such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into SPARC SAWG you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within SPARC SAWG that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X