Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 11 showing 201 ~ 220 out of 32,424 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_104105

    This resource has 1+ mentions.

http://www.addgene.org/104105

Species: Discosoma sp.
Genetic Insert: tdTomato
Vector Backbone Description: Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104105 Copy   


  • RRID:Addgene_104104

    This resource has 1+ mentions.

http://www.addgene.org/104104

Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104104 Copy   


  • RRID:Addgene_104112

    This resource has 1+ mentions.

http://www.addgene.org/104112

Species: Discosoma sp.
Genetic Insert: tdTomato
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104112 Copy   


  • RRID:Addgene_104111

    This resource has 1+ mentions.

http://www.addgene.org/104111

Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104111 Copy   


http://www.addgene.org/104114

Species: Synthetic
Genetic Insert: CheRiff-CFP
Vector Backbone Description: Backbone Size:9000; Vector Backbone:fCAG-FLEX; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587

Proper citation: RRID:Addgene_104114 Copy   


  • RRID:Addgene_104110

    This resource has 1+ mentions.

http://www.addgene.org/104110

Species: Aequorea victoria
Genetic Insert: mTurquoise2
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104110 Copy   


  • RRID:Addgene_104330

    This resource has 1+ mentions.

http://www.addgene.org/104330

Genetic Insert: TVA-mCherry fusion protein
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV, Adeno Associated Viral Vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28689641

Proper citation: RRID:Addgene_104330 Copy   


  • RRID:Addgene_104309

    This resource has 1+ mentions.

http://www.addgene.org/104309

Species: Other
Genetic Insert: mito-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024

Proper citation: RRID:Addgene_104309 Copy   


http://www.addgene.org/104274

Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRD

Proper citation: RRID:Addgene_104274 Copy   


  • RRID:Addgene_104355

    This resource has 1+ mentions.

http://www.addgene.org/104355

Species: Homo sapiens
Genetic Insert: Human integrin b2 with tension sensor
Vector Backbone Description: Backbone Size:5596; Vector Backbone:pcDNA3.1/Hygro(-); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27721490

Proper citation: RRID:Addgene_104355 Copy   


  • RRID:DGRC_1660994

    This resource has 1+ mentions.

https://dgrc.bio.indiana.edu/stock/1660994

Species: Drosophila melanogaster
Comments: BDGP Gold cDNAs

Proper citation: RRID:DGRC_1660994 Copy   


  • RRID:Addgene_106867

    This resource has 1+ mentions.

http://www.addgene.org/106867

Species: Homo sapiens
Genetic Insert: ALG14
Vector Backbone Description: Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29315387

Proper citation: RRID:Addgene_106867 Copy   


http://www.addgene.org/106941

Species: Homo sapiens
Genetic Insert: human Importin beta-1 (KPNB1)
Vector Backbone Description: Backbone Marker: Clontech ; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:15572412
Comments: This plasmid was created by Antonella Palena in the Lavia Lab.

Proper citation: RRID:Addgene_106941 Copy   


  • RRID:Addgene_107000

    This resource has 1+ mentions.

http://www.addgene.org/107000

Species: Mus musculus
Genetic Insert: tristetraprolin
Vector Backbone Description: Backbone Marker:Thermo Scientific; Vector Backbone:pTRIPZ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29246442
Comments: Please note- Addgene's quality control found one “g” nucleotide missing from the insert sequence. The depositor noted this "g" should make no difference to the function of plasmid, since it is located within an intron and will be spliced out.

Proper citation: RRID:Addgene_107000 Copy   


  • RRID:Addgene_106834

    This resource has 1+ mentions.

http://www.addgene.org/106834

Species: Homo sapiens
Genetic Insert: UGGT2
Vector Backbone Description: Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29315387

Proper citation: RRID:Addgene_106834 Copy   


  • RRID:Addgene_106833

    This resource has 1+ mentions.

http://www.addgene.org/106833

Species: Homo sapiens
Genetic Insert: UGGT1
Vector Backbone Description: Backbone Marker:Eric-Paul Bennett (Addgene plasmid # 68369); Backbone Size:2376; Vector Backbone:EPB104; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29315387

Proper citation: RRID:Addgene_106833 Copy   


  • RRID:Addgene_10688

    This resource has 1+ mentions.

http://www.addgene.org/10688

Species: Homo sapiens
Genetic Insert: hTERT shRNA
Vector Backbone Description: Backbone Size:6700; Vector Backbone:pMKO.1; Vector Types:Mammalian Expression, Retroviral, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15928077
Comments: hTERT 3114-3134 (coding region): Forward TTTCATCAGCAAGTTTGGAttcaagagaTCCAAACTTGCTGATGAAAtttttg ; Reverse aattcaaaaaTTTCATCAGCAAGTTTGGAtctcttgaaTCCAAACTTGCTGATGAAA .

Proper citation: RRID:Addgene_10688 Copy   


  • RRID:Addgene_106924

    This resource has 1+ mentions.

http://www.addgene.org/106924

Genetic Insert: FKBP-EGFP-HOTag3
Vector Backbone Description: Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29307513

Proper citation: RRID:Addgene_106924 Copy   


http://www.addgene.org/10695

Species: Homo sapiens
Genetic Insert: FKHR deltaDB
Vector Backbone Description: Backbone Size:5200; Vector Backbone:pBabe puro L; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_10695 Copy   


http://www.addgene.org/10694

Species: Homo sapiens
Genetic Insert: FKHR deltaDB
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_10694 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. SPARC Anatomical Working Group Resources

    Welcome to the SPARC SAWG Resources search. From here you can search through a compilation of resources used by SPARC SAWG and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that SPARC SAWG has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on SPARC SAWG then you can log in from here to get additional features in SPARC SAWG such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into SPARC SAWG you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within SPARC SAWG that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X