Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: 2ndVal mGFPmut2
Vector Backbone Description: Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29320486
Comments: This is a version of mGFPmut2 with a valine inserted in the second position. Please see "Notes On Plasmids In This Collection" document for further details and references.
Proper citation: RRID:Addgene_104033 Copy
Species: Synthetic
Genetic Insert: mYPet
Vector Backbone Description: Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29320486
Comments: This FP derives from wtGFP. In this plasmid, the FP is coded with the original wtGFP nucleotide coding sequence except where mutations specific to the FP occur (see map). Please see "Notes On Plasmids In This Collection" document for further details and references.
Proper citation: RRID:Addgene_103988 Copy
Species: Synthetic
Genetic Insert: mVenus JBC
Vector Backbone Description: Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29320486
Comments: This FP derives from wtGFP. In this plasmid, the FP is coded with the original wtGFP nucleotide coding sequence except where mutations specific to the FP occur (see map). Please see "Notes On Plasmids In This Collection" document for further details and references.
Proper citation: RRID:Addgene_103987 Copy
Species: Synthetic
Genetic Insert: moxGFP
Vector Backbone Description: Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29320486
Comments: This FP derives from wtGFP. In this plasmid, the FP is coded with the original wtGFP nucleotide coding sequence except where mutations specific to the FP occur (see map). Please see "Notes On Plasmids In This Collection" document for further details and references.
Proper citation: RRID:Addgene_103984 Copy
Species: Synthetic
Genetic Insert: E2-Crimson
Vector Backbone Description: Backbone Size:3224; Vector Backbone:pEB2; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29320486
Comments: This FP derives from DsRed. Please see "Notes On Plasmids In This Collection" document for further details and references.
Proper citation: RRID:Addgene_104010 Copy
Species: Synthetic
Genetic Insert: comCerulean3
Vector Backbone Description: Backbone Size:3674; Vector Backbone:pEB1; Vector Types:Bacterial Expression, Low copy; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29320486
Comments: This is a codon optimized version of mCerulean3. Please see "Notes On Plasmids In This Collection" document for further details and references.
Proper citation: RRID:Addgene_104017 Copy
Species: Other
Genetic Insert: eCas9-1.1
Vector Backbone Description: Vector Backbone:p3s; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29141659
Proper citation: RRID:Addgene_104172 Copy
Species: Vicugna pacos
Genetic Insert: Anti-rabbit IgG Fc specific nanobody TP897 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104163 Copy
Species: Vicugna pacos
Genetic Insert: Anti-mouse kappa chain specific nanobody TP1170 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104162 Copy
Species: Homo sapiens
Genetic Insert: NEDD4 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDN
Proper citation: RRID:Addgene_104208 Copy
Genetic Insert: U6-CUGsgRNA, EFS-PIN-dCas9
Vector Backbone Description: Vector Backbone:LentiCRISPR v2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28803727
Proper citation: RRID:Addgene_104183 Copy
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
Proper citation: RRID:Addgene_104215 Copy
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI
Proper citation: RRID:Addgene_104214 Copy
Species: Vicugna pacos
Genetic Insert: Anti-mouse IgG1 Fc specific nanobody TP1107 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104158 Copy
Species: Vicugna pacos
Genetic Insert: Anti-mouse IgG1 Fab specific nanobody TP886
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104157 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP29
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28538170
Proper citation: RRID:Addgene_104154 Copy
Species: Brachypodium distachyon
Genetic Insert: NEDD8-specific protease 1 (NEDP1)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Comments: Supporting reference: A new set of highly efficient, tag-cleaving proteases for purifying recombinant proteins. J Chromatogr A. 2014 Apr 11;1337:95-105. doi: 10.1016/j.chroma.2014.02.029
Proper citation: RRID:Addgene_104129 Copy
Species: Renilla reniformis
Genetic Insert: Renilla luciferase
Vector Backbone Description: Vector Backbone:pSF4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29056324
Proper citation: RRID:Addgene_104097 Copy
Species: Synthetic
Genetic Insert: stdMCP-Halo
Vector Backbone Description: Vector Backbone:pHAGE-UbiC; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29056324
Proper citation: RRID:Addgene_104098 Copy
Species: Synthetic
Genetic Insert: Plpp chAcK3RS(IPYE); PproK pyl
Vector Backbone Description: Backbone Marker:Liu Lab; Vector Backbone:p15A; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29035361
Proper citation: RRID:Addgene_104069 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the SPARC SAWG Resources search. From here you can search through a compilation of resources used by SPARC SAWG and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that SPARC SAWG has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on SPARC SAWG then you can log in from here to get additional features in SPARC SAWG such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into SPARC SAWG you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within SPARC SAWG that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.