Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847659
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): DHRS7C
Proper citation: Atlas Antibodies Cat# HPA027113, RRID:AB_1847659 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_591440
Comments: manufacturer recommendations: IgG; IgG Immunohistochemistry; IHC
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): G Protein-Coupled Receptor D-GPCR
Proper citation: LSBio (LifeSpan) Cat# LS-A1854, RRID:AB_591440 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078203
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): ARHGEF6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA003578, RRID:AB_1078203 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078212
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ARMCX5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000996, RRID:AB_1078212 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1843923
Comments: Vendor recommendations: IgG2akappa indirect ELISA: suitable, immunoblotting: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; ELISA; Immunohistochemistry; Western Blot
Host Organism: mouse
Clonality monoclonal
Target(s): TFAP4 antibody produced in mouse
Proper citation: Sigma-Aldrich Cat# WH0007023M3, RRID:AB_1843923 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335669
Comments: Used By NYUIHC-274
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: Cornell University; New York; USA Cat# AT002, RRID:AB_2335669 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666287
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GAB2
Proper citation: Atlas Antibodies Cat# HPA001368, RRID:AB_2666287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680812
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): C2orf88
Proper citation: Atlas Antibodies Cat# HPA049549, RRID:AB_2680812 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10610279
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PHACTR2
Proper citation: Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616533
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): Psc
Proper citation: Vincenzo Pirrotta Cat# non-commercial Psc modENCODE antibody 1, RRID:AB_2616533 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682709
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM170B
Proper citation: Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2072056
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CCDC146
Proper citation: Atlas Antibodies Cat# HPA020105, RRID:AB_2072056 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667540
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): KIF2C
Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078701
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TNFRSF21
Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078756
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ELF3
Proper citation: Atlas Antibodies Cat# HPA003479, RRID:AB_1078756 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670967
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AGA
Proper citation: Atlas Antibodies Cat# HPA031417, RRID:AB_10670967 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672746
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): BFSP2
Proper citation: Atlas Antibodies Cat# HPA038464, RRID:AB_10672746 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852144
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human KCNMB3
Proper citation: Sigma-Aldrich Cat# HPA019185, RRID:AB_1852144 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851462
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human IFT81
Proper citation: Sigma-Aldrich Cat# HPA019087, RRID:AB_1851462 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855164
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PDZK1
Proper citation: Atlas Antibodies Cat# HPA005755, RRID:AB_1855164 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the SPARC SAWG Resources search. From here you can search through a compilation of resources used by SPARC SAWG and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that SPARC SAWG has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on SPARC SAWG then you can log in from here to get additional features in SPARC SAWG such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into SPARC SAWG you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within SPARC SAWG that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.