Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681867
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OR2D3
Proper citation: Atlas Antibodies Cat# HPA052551, RRID:AB_2681867 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10793983
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): AC092329.1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042724, RRID:AB_10793983 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681869
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBC1D3L
Proper citation: Atlas Antibodies Cat# HPA052553, RRID:AB_2681869 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601126
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): CFAP77
Proper citation: Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845581
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CMC2
Proper citation: Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682504
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CAV3
Proper citation: Atlas Antibodies Cat# HPA054488, RRID:AB_2682504 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080230
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human TCF12
Proper citation: Sigma-Aldrich Cat# HPA002103, RRID:AB_1080230 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1843301
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 08248-4E12 for any cell type or tissues; status is awaiting lab characterization
Host Organism: mouse
Clonality monoclonal
Target(s): RBPJ
Proper citation: Sigma-Aldrich Cat# WH0003516M1, RRID:AB_1843301 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844449
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ABHD3
Proper citation: Sigma-Aldrich Cat# HPA010729, RRID:AB_1844449 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853523
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): LAMTOR3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026858, RRID:AB_1853523 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669881
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TSSC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031231, RRID:AB_10669881 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10618352
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40807 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): PYGO2
Proper citation: GeneTex Cat# GTX119726, RRID:AB_10618352 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670163
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): PAFAH1B3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035639, RRID:AB_10670163 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600897
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ZBTB8B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028690, RRID:AB_10600897 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671102
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): PARD3B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035283, RRID:AB_10671102 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10612119
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): HS6ST2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA034625, RRID:AB_10612119 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601929
Comments: Vendor recommendations: Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF274 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028880, RRID:AB_10601929 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602239
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KCND3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029452, RRID:AB_10602239 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078269
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human BAZ1A
Proper citation: Sigma-Aldrich Cat# HPA002730, RRID:AB_1078269 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795174
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): NUDT22 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA039334, RRID:AB_10795174 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the SPARC SAWG Resources search. From here you can search through a compilation of resources used by SPARC SAWG and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that SPARC SAWG has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on SPARC SAWG then you can log in from here to get additional features in SPARC SAWG such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into SPARC SAWG you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within SPARC SAWG that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
