Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/13130
Proper Citation: RRID:Addgene_13130
Insert Name: ZF31
Bacterial Resistance: Ampicillin
Defining Citation: PMID:17406455
Vector Backbone Description: Backbone Marker:Modified Invitrogen pcDNA3; Backbone Size:5400; Vector Backbone:pc3XB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGERPFMCTWSYCGKRFTRSDALSRHKRTH. Target DNA sequence: GTG. This zinc finger is derived from the Sangamo module set.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for pc3XB-ZF31.
No alerts have been found for pc3XB-ZF31.
Source: Addgene