Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: CIPK2-upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MENKPSVLTERYEVGRLLGQGTFAKVYFGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPMEAGGSGQNENGENHEPPRLATLNAFDIIALSTGFGLAGLFGDVYDKRESRFASQKPASEIISKLVEVAKCLKLKIRKQGAGLFKLERVKEGKNGILTMDAEIFQVTPTFHLVEVKKCNGDTMEYQKLVEEDLRPALADIVWVWQGEKEKEEQLLQDEQGEQEPS
Proper citation: RRID:Addgene_117863 Copy
Species: Arabidopsis thaliana
Genetic Insert: CBL5-uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117868 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117901 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-mCitrine
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Comments: mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function.
Proper citation: RRID:Addgene_117989 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSHHHHHH
Proper citation: RRID:Addgene_117900 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117899 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH
Proper citation: RRID:Addgene_117898 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Agilent Technologies; Backbone Size:6571; Vector Backbone:pESC-URA; Vector Types:Yeast Expression, Yeast/bacteria binary vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117997 Copy
Species: Arabidopsis thaliana
Genetic Insert: CURT_fluoB
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3956; Vector Backbone:pBAD; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30884945
Proper citation: RRID:Addgene_117999 Copy
Species: Arabidopsis thaliana
Genetic Insert: AIP2
Vector Backbone Description: Vector Backbone:pER8 cHA; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain
Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118687 Copy
Species: Arabidopsis thaliana
Genetic Insert: PHL2
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118682 Copy
Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118685 Copy
Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pDEST 565; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118675 Copy
Species: Arabidopsis thaliana
Genetic Insert: AIP2
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118678 Copy
Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pDEST 566; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118677 Copy
Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pDEST 527; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118671 Copy
Species: Arabidopsis thaliana
Genetic Insert: PHL2
Vector Backbone Description: Vector Backbone:pDEST 565; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118674 Copy
Species: Arabidopsis thaliana
Genetic Insert: AT3G07200
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Other; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28400782
Comments: Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118681 Copy
Species: Arabidopsis thaliana
Genetic Insert: AIP2
Vector Backbone Description: Vector Backbone:pBA cMYC; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain
Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118667 Copy
Species: Arabidopsis thaliana
Genetic Insert: XERICO
Vector Backbone Description: Vector Backbone:pBA cHA; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:28400782
Comments: 28 C in GV3101 (pMP90) strain
Our work is based on genomic approaches in Arabidopsis thaliana and groups of genes are presented in all of the following publications:
Pavicic Mirko (2019). Multifaceted roles of RING-type ubiquitin E3 ligases: reverse phenomic approaches. http://urn.fi/URN:ISBN:978-951-51-5483-5
Pavicic M., Mouhu K., Wang F., Bilicka M., Chovancek E., & Himanen K. (2017). Genomic and phenomic screens for flower related RING type ubiquitin E3 ligases in Arabidopsis. Frontiers in Plant Science. doi.org/10.3389/fpls.2017.00416
Pavicic M., Wang F., Mouhu K., Himanen K. (2019). High throughput in vitro seed germination screen identified new ABA responsive RING-type ubiquitin E3 ligases in Arabidopsis thaliana. Plant Cell Tissue and Organ Culture. https://link.springer.com/article/10.1007/s11240-019-01700-9
Proper citation: RRID:Addgene_118666 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within PRECISE-TBI that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.