Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 3 showing 41 ~ 60 out of 566 results
Snippet view Table view Download 566 Result(s)
Click the to add this resource to a Collection
  • RRID:Addgene_117894

http://www.addgene.org/117894

Species: Oryza sativa
Genetic Insert: OsPQL uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MGIFSGAGAHRPSCPSAANCAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTWSANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGTTHQEVPNGIVIPVGRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGRLPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVLLDTFIILQFLYFHYRKRHVPDEPDSADKVENLYQSHHHHHH

Proper citation: RRID:Addgene_117894 Copy   


  • RRID:Addgene_117890

http://www.addgene.org/117890

Species: Triticum aestivum
Genetic Insert: TaALMT1-uPIC 5'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117890 Copy   


  • RRID:Addgene_117893

http://www.addgene.org/117893

Species: Triticum aestivum
Genetic Insert: TaALMT1-upGFP 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117893 Copy   


  • RRID:Addgene_117899

http://www.addgene.org/117899

Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH

Proper citation: RRID:Addgene_117899 Copy   


  • RRID:Addgene_117898

http://www.addgene.org/117898

Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH

Proper citation: RRID:Addgene_117898 Copy   


  • RRID:Addgene_118386

    This resource has 1+ mentions.

http://www.addgene.org/118386

Species: Other
Genetic Insert: CAS9p-TagRFP
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420

Proper citation: RRID:Addgene_118386 Copy   


  • RRID:Addgene_118385

http://www.addgene.org/118385

Species: Other
Genetic Insert: CAS9p
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420

Proper citation: RRID:Addgene_118385 Copy   


  • RRID:Addgene_117088

http://www.addgene.org/117088

Species: Arabidopsis thaliana
Genetic Insert: AtPIN1
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117088 Copy   


  • RRID:Addgene_117089

http://www.addgene.org/117089

Species: Arabidopsis thaliana
Genetic Insert: AtPIN2
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117089 Copy   


  • RRID:Addgene_117095

http://www.addgene.org/117095

Species: Other
Genetic Insert: MtPT4-eGFP
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117095 Copy   


  • RRID:Addgene_117096

http://www.addgene.org/117096

Species: Other
Genetic Insert: MtPT4
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117096 Copy   


  • RRID:Addgene_117090

http://www.addgene.org/117090

Species: Arabidopsis thaliana
Genetic Insert: AtNPY1
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117090 Copy   


  • RRID:Addgene_117103

http://www.addgene.org/117103

Species: Arabidopsis thaliana
Genetic Insert: SLAC-deltaCdeltaN
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117103 Copy   


  • RRID:Addgene_117102

http://www.addgene.org/117102

Species: Arabidopsis thaliana
Genetic Insert: SLAC-deltaC
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117102 Copy   


  • RRID:Addgene_117105

http://www.addgene.org/117105

Species: Arabidopsis thaliana
Genetic Insert: SLAH3
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117105 Copy   


  • RRID:Addgene_117100

http://www.addgene.org/117100

Species: Arabidopsis thaliana
Genetic Insert: SLAC1-FL
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117100 Copy   


  • RRID:Addgene_117098

http://www.addgene.org/117098

Species: Arabidopsis thaliana
Genetic Insert: MCA2-eGFP
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)

Proper citation: RRID:Addgene_117098 Copy   


http://www.addgene.org/117663

Species: Other
Genetic Insert: pOst1-pro-af(MUT2)-E2-Crimson
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.

Proper citation: RRID:Addgene_117663 Copy   


http://www.addgene.org/117665

Species: Other
Genetic Insert: pre-Ost1-pro-alphaf-Btl2
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.

Proper citation: RRID:Addgene_117665 Copy   


http://www.addgene.org/117660

Species: Other
Genetic Insert: pre-pro-alphaf(I)-E2-Crimson
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.

Proper citation: RRID:Addgene_117660 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. PRECISE-TBI Resources

    Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within PRECISE-TBI that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X