Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Bacterial Resistance:streptomycin (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

228 Results - per page

Show More Columns | Download 228 Result(s)

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pOxyR_gfp
 
Resource Report
Resource Website 		RRID:Addgene_194154 transcriptional regulator, OxyR, cognate promoter PoxyS, fluorescent protein sfGFP E. coli Streptomycin PMID:34820092 Backbone Marker:https://seva-plasmids.com/; Backbone Size:2390; Vector Backbone:pSEVA-based; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:15:51 0
pOxyR_rfp
 
Resource Report
Resource Website 		RRID:Addgene_194155 transcriptional regulator, OxyR, cognate promoter PoxyS, fluorescent protein mCherry E. coli Streptomycin PMID:34820092 Backbone Marker:https://seva-plasmids.com/; Backbone Size:2754; Vector Backbone:pSEVA-based; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:15:51 0
pHBJT023
 
Resource Report
Resource Website 		RRID:Addgene_225174 Streptomycin PMID:39244484 Low copy plasmid (pSC101 ori and repA), pUC19 MCS, confers streptomycin resistance Backbone Size:5007; Vector Backbone:Unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-29 01:21:33 0
pHBJT014
 
Resource Report
Resource Website 		RRID:Addgene_225165 Streptomycin PMID:39244484 Low copy plasmid (pSC101 ori and repA), pUC18 MCS with FLAG epitope integrated at SmaI site, confers streptomycin resistance Backbone Size:4769; Vector Backbone:Unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-29 01:21:33 0
pHBJT013
 
Resource Report
Resource Website 		RRID:Addgene_225164 Streptomycin PMID:39244484 Low copy plasmid (pSC101 ori and repA), pUC19 MCS with FLAG epitope integrated at SmaI site, confers streptomycin resistance Backbone Size:4769; Vector Backbone:Unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-29 01:21:33 0
pRoRL
 
Resource Report
Resource Website 		RRID:Addgene_213132 Streptomycin PMID:39126322 Backbone Size:5261; Vector Backbone:CloDF13; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin 2026-08-29 01:20:39 0
PCDF Bravo-PotH-OL1del
 
Resource Report
Resource Website 		RRID:Addgene_216749 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 1 (OL1) with the sequence of [FKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQ] is deleted. 2026-08-29 01:20:48 0
PCDF Bravo-PotH-OL2del
 
Resource Report
Resource Website 		RRID:Addgene_216750 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted. 2026-08-29 01:20:55 0
PCDF Bravo-PotH-OL3/2sub
 
Resource Report
Resource Website 		RRID:Addgene_216752 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW]. 2026-08-29 01:20:48 0
PCDF Bravo-PotH-OL3del
 
Resource Report
Resource Website 		RRID:Addgene_216751 potH E. coli (Bacteria) Streptomycin PMID:40154612 IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 3 (OL3) with the sequence of [ELLGGPDSIMIGRVLWQEFFNNRDW] is deleted. 2026-08-29 01:20:48 0
p35S:RUBY 5’ CYSTM α
 
Resource Report
Resource Website 		RRID:Addgene_247493 5′ CYSTM α (From the 5' UTR of CYSTM1 gene) Arabidopsis thaliana Streptomycin PMID:42194977 Please visit https://doi.org/10.1101/2025.10.15.682649 for bioRxiv preprint. Backbone Size:14340; Vector Backbone:pCAMBIA; Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:19 0
pCDFDuet-1:ChrH
 
Resource Report
Resource Website 		RRID:Addgene_257760 ChrH Chryseobacterium sp. JM1 Streptomycin PMID:41911463 Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:31 0
pCDFDuet-1:MelH
 
Resource Report
Resource Website 		RRID:Addgene_257765 MelH Melainabacteria bacterium isolate SJ512 Streptomycin PMID:41911463 Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:27 0
pCDFDuet-1:HymH
 
Resource Report
Resource Website 		RRID:Addgene_257763 HymH Hymenobacter gelipurpurascens DSM 11116 Streptomycin PMID:41911463 Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:31 0
pCDFDuet-1:MCS1_NedB_MCS2_NedC
 
Resource Report
Resource Website 		RRID:Addgene_257772 NedB and NedC Neisseria dentiae CCUG 53898 310003 Streptomycin PMID:41911463 Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:31 0
Sc RFC5(SAC)-pCDFDuet
 
Resource Report
Resource Website 		RRID:Addgene_258210 Sc RFC5 (mutant) Saccharomyces cerevisiae Streptomycin Mix & Match (co-transform) with other vectors to over-express Sc RFC complex or related complexes (with Sc RFC1 substituted by Sc rad24, Sc ctf18, or Sc Elg1) containing the desired mutation(s). Expression in CodonPlus(RIL) or other strain containing rare Sc tRNA genes recommended. Vector Backbone:pCDFDuet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin RFC5 (K184A) (SAC) 2026-08-29 01:27:33 0
pCDFDuet-1:MCS1_His-MelH_MCS2_MelHc
 
Resource Report
Resource Website 		RRID:Addgene_257767 His-MelH and MelHc Melainabacteria bacterium isolate SJ512 Streptomycin PMID:41911463 Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:43 0
pZASS-adhT
 
Resource Report
Resource Website 		RRID:Addgene_231854 adhT Parageobacillus thermoglucosidasius Streptomycin PMID:40245979 Please visit https://doi.org/10.1101/2024.10.31.621308 for bioRxiv preprint. Vector Backbone:pZASS; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2026-08-29 01:27:46 0
pQCasTns(Vch)-entry(BsaI)
 
Resource Report
Resource Website 		RRID:Addgene_190273 VchTniQ, VchCas5/8, VchCas7, VchCas6, VchTnsABC, CRISPR(BsaI) Vibrio cholera Streptomycin PMID:34478496 Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin no 2026-08-29 01:19:21 0
pRAW-460
 
Resource Report
Resource Website 		RRID:Addgene_200216 PaCas1, PaCas2-3 Pseudomonas aeruginosa PA14 Streptomycin PMID:37710013 Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Cas2 R55E-N56D mutations 2026-08-29 01:19:24 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. PRECISE-TBI Resources

    Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The PRECISE-TBI toolbox are a collection tools and resources to increase rigor and reproducibility with Traumatic Brain Injury within the PRE Clinical Interagency reSearch resourcE - Traumatic Brain Injury (PRECISE-TBI). Please learn more about PRECISE-TBI at https://www.precise-tbi.org

Recent News Entries

Contact Us

Department of Neurosciences, School of Medicine

University of California, San Diego





About SciCrunch | Privacy Policy | Terms of Service

SciCrunch