Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pOxyR_gfp Resource Report Resource Website |
RRID:Addgene_194154 | transcriptional regulator, OxyR, cognate promoter PoxyS, fluorescent protein sfGFP | E. coli | Streptomycin | PMID:34820092 | Backbone Marker:https://seva-plasmids.com/; Backbone Size:2390; Vector Backbone:pSEVA-based; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:15:51 | 0 | ||
|
pOxyR_rfp Resource Report Resource Website |
RRID:Addgene_194155 | transcriptional regulator, OxyR, cognate promoter PoxyS, fluorescent protein mCherry | E. coli | Streptomycin | PMID:34820092 | Backbone Marker:https://seva-plasmids.com/; Backbone Size:2754; Vector Backbone:pSEVA-based; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:15:51 | 0 | ||
|
pHBJT023 Resource Report Resource Website |
RRID:Addgene_225174 | Streptomycin | PMID:39244484 | Low copy plasmid (pSC101 ori and repA), pUC19 MCS, confers streptomycin resistance | Backbone Size:5007; Vector Backbone:Unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin | 2026-08-29 01:21:33 | 0 | |||
|
pHBJT014 Resource Report Resource Website |
RRID:Addgene_225165 | Streptomycin | PMID:39244484 | Low copy plasmid (pSC101 ori and repA), pUC18 MCS with FLAG epitope integrated at SmaI site, confers streptomycin resistance | Backbone Size:4769; Vector Backbone:Unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin | 2026-08-29 01:21:33 | 0 | |||
|
pHBJT013 Resource Report Resource Website |
RRID:Addgene_225164 | Streptomycin | PMID:39244484 | Low copy plasmid (pSC101 ori and repA), pUC19 MCS with FLAG epitope integrated at SmaI site, confers streptomycin resistance | Backbone Size:4769; Vector Backbone:Unknown; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin | 2026-08-29 01:21:33 | 0 | |||
|
pRoRL Resource Report Resource Website |
RRID:Addgene_213132 | Streptomycin | PMID:39126322 | Backbone Size:5261; Vector Backbone:CloDF13; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Streptomycin | 2026-08-29 01:20:39 | 0 | ||||
|
PCDF Bravo-PotH-OL1del Resource Report Resource Website |
RRID:Addgene_216749 | potH | E. coli (Bacteria) | Streptomycin | PMID:40154612 | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 1 (OL1) with the sequence of [FKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQ] is deleted. | 2026-08-29 01:20:48 | 0 |
|
PCDF Bravo-PotH-OL2del Resource Report Resource Website |
RRID:Addgene_216750 | potH | E. coli (Bacteria) | Streptomycin | PMID:40154612 | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted. | 2026-08-29 01:20:55 | 0 |
|
PCDF Bravo-PotH-OL3/2sub Resource Report Resource Website |
RRID:Addgene_216752 | potH | E. coli (Bacteria) | Streptomycin | PMID:40154612 | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW]. | 2026-08-29 01:20:48 | 0 |
|
PCDF Bravo-PotH-OL3del Resource Report Resource Website |
RRID:Addgene_216751 | potH | E. coli (Bacteria) | Streptomycin | PMID:40154612 | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 3 (OL3) with the sequence of [ELLGGPDSIMIGRVLWQEFFNNRDW] is deleted. | 2026-08-29 01:20:48 | 0 |
|
p35S:RUBY 5’ CYSTM α Resource Report Resource Website |
RRID:Addgene_247493 | 5′ CYSTM α (From the 5' UTR of CYSTM1 gene) | Arabidopsis thaliana | Streptomycin | PMID:42194977 | Please visit https://doi.org/10.1101/2025.10.15.682649 for bioRxiv preprint. | Backbone Size:14340; Vector Backbone:pCAMBIA; Vector Types:Bacterial Expression, Plant Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:19 | 0 | |
|
pCDFDuet-1:ChrH Resource Report Resource Website |
RRID:Addgene_257760 | ChrH | Chryseobacterium sp. JM1 | Streptomycin | PMID:41911463 | Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:31 | 0 | |
|
pCDFDuet-1:MelH Resource Report Resource Website |
RRID:Addgene_257765 | MelH | Melainabacteria bacterium isolate SJ512 | Streptomycin | PMID:41911463 | Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:27 | 0 | |
|
pCDFDuet-1:HymH Resource Report Resource Website |
RRID:Addgene_257763 | HymH | Hymenobacter gelipurpurascens DSM 11116 | Streptomycin | PMID:41911463 | Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:31 | 0 | |
|
pCDFDuet-1:MCS1_NedB_MCS2_NedC Resource Report Resource Website |
RRID:Addgene_257772 | NedB and NedC | Neisseria dentiae CCUG 53898 310003 | Streptomycin | PMID:41911463 | Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:31 | 0 | |
|
Sc RFC5(SAC)-pCDFDuet Resource Report Resource Website |
RRID:Addgene_258210 | Sc RFC5 (mutant) | Saccharomyces cerevisiae | Streptomycin | Mix & Match (co-transform) with other vectors to over-express Sc RFC complex or related complexes (with Sc RFC1 substituted by Sc rad24, Sc ctf18, or Sc Elg1) containing the desired mutation(s). Expression in CodonPlus(RIL) or other strain containing rare Sc tRNA genes recommended. | Vector Backbone:pCDFDuet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | RFC5 (K184A) (SAC) | 2026-08-29 01:27:33 | 0 | |
|
pCDFDuet-1:MCS1_His-MelH_MCS2_MelHc Resource Report Resource Website |
RRID:Addgene_257767 | His-MelH and MelHc | Melainabacteria bacterium isolate SJ512 | Streptomycin | PMID:41911463 | Please visit https://doi.org/10.1101/2025.10.31.685832 for bioRxiv preprint. | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:43 | 0 | |
|
pZASS-adhT Resource Report Resource Website |
RRID:Addgene_231854 | adhT | Parageobacillus thermoglucosidasius | Streptomycin | PMID:40245979 | Please visit https://doi.org/10.1101/2024.10.31.621308 for bioRxiv preprint. | Vector Backbone:pZASS; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2026-08-29 01:27:46 | 0 | |
|
pQCasTns(Vch)-entry(BsaI) Resource Report Resource Website |
RRID:Addgene_190273 | VchTniQ, VchCas5/8, VchCas7, VchCas6, VchTnsABC, CRISPR(BsaI) | Vibrio cholera | Streptomycin | PMID:34478496 | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | no | 2026-08-29 01:19:21 | 0 | |
|
pRAW-460 Resource Report Resource Website |
RRID:Addgene_200216 | PaCas1, PaCas2-3 | Pseudomonas aeruginosa PA14 | Streptomycin | PMID:37710013 | Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Cas2 R55E-N56D mutations | 2026-08-29 01:19:24 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.