Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Oryza sativa
Genetic Insert: OsSLAC1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH
Proper citation: RRID:Addgene_117904 Copy
Genetic Insert: sgRNA backbone (F+E)
Vector Backbone Description: Vector Backbone:pCESAx (Addgene 59986); Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30580963
Comments: Users should follow the oligo cloning protocol for plasmid lentiCRISPR v2 (Addgene #52961) to 1) remove stuffer fragment and 2) insert annealed oligos to complete gRNA.
Proper citation: RRID:Addgene_117986 Copy
Species: Arabidopsis thaliana
Genetic Insert: CTP-mCitrine
Vector Backbone Description: Backbone Size:9204; Vector Backbone:pN_35S; Vector Types:Plant Expression, Plant/bacteria binary vector; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:30884945
Comments: mCitrine contains an L7E compared to the published mCitrine sequence that does not impact plasmid function.
Proper citation: RRID:Addgene_117989 Copy
Species: Homo sapiens
Genetic Insert: Clover-Prx2-mRuby2
Vector Backbone Description: Backbone Size:7330; Vector Backbone:pLJM1; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30087344
Proper citation: RRID:Addgene_117907 Copy
Species: Synthetic
Genetic Insert: SNAP_Pro30_[cpNLuc23_24]eDHFR(R98A)
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5218; Vector Backbone:pET51-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30213915
Proper citation: RRID:Addgene_117909 Copy
Species: Rattus norvegicus
Genetic Insert: GABRG3
Vector Backbone Description: Vector Backbone:pCDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_118041 Copy
Species: Rattus norvegicus
Genetic Insert: GABRG2
Vector Backbone Description: Vector Backbone:pEGFP N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_118040 Copy
Vector Backbone Description: Backbone Marker:Self made; Derived from pBluescriptSK; Backbone Size:2804; Vector Backbone:pUPD; Vector Types:Synthetic Biology, Domestication of DNA parts for GoldenBraid asembly; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:31836712
Comments: This is a GB2.0 domesticator vector. GBParts can be assembled in a BsmBI-ligation reaction. Any assembled Part can be released with BsaI for further cloning into Alpha level vectors.
Proper citation: RRID:Addgene_118043 Copy
Species: Rattus norvegicus
Genetic Insert: GABRG3
Vector Backbone Description: Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_118042 Copy
Species: Synthetic
Genetic Insert: TRE-dDIO-vCre
Vector Backbone Description: Vector Backbone:pAAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30455464
Comments: Note: vCre contains an A347T mutation. This mutation is not known to affect plasmid function.
Proper citation: RRID:Addgene_118029 Copy
Species: Homo sapiens
Genetic Insert: sgTP53-5
Vector Backbone Description: Backbone Marker:Feng Zhang Lab; Backbone Size:9482; Vector Backbone:pXPR003; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30224644
Comments: High efficiency of TP53 deletion
Proper citation: RRID:Addgene_118023 Copy
Species: Homo sapiens
Genetic Insert: sgTP53-4
Vector Backbone Description: Backbone Marker:Feng Zhang Lab; Backbone Size:9482; Vector Backbone:pXPR003; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30224644
Comments: High efficiency of TP53 deletion
Proper citation: RRID:Addgene_118022 Copy
Species: Synthetic
Genetic Insert: 2xNLS-mTurquoise2
Vector Backbone Description: Backbone Size:4561; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Proper citation: RRID:Addgene_118025 Copy
Species: Staphylococcus epidermidis
Genetic Insert: SdrG_N2N3-B1-B2
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5216; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30420680
Proper citation: RRID:Addgene_117979 Copy
Species: Synthetic
Genetic Insert: TRE-vDIO-mScarlet-IRES-tTA
Vector Backbone Description: Vector Backbone:pAAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30455464
Proper citation: RRID:Addgene_118030 Copy
Species: Synthetic
Genetic Insert: eGFP
Vector Backbone Description: Backbone Size:4935; Vector Backbone:pSIRV; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26780292
Proper citation: RRID:Addgene_118031 Copy
Genetic Insert: sfTq2ox-PBP5
Vector Backbone Description: Vector Backbone:pTHV037; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30648295
Proper citation: RRID:Addgene_117960 Copy
Species: Homo sapiens
Genetic Insert: TP53
Vector Backbone Description: Backbone Marker:Broad Institute; Backbone Size:8767; Vector Backbone:pLX313; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30224644
Proper citation: RRID:Addgene_118015 Copy
Species: S. pyrogenes
Genetic Insert: Cas9
Vector Backbone Description: Backbone Marker:Broad Institute; Backbone Size:8767; Vector Backbone:pLX311; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30224644
Proper citation: RRID:Addgene_118018 Copy
Species: P. pyralis
Genetic Insert: Firefly luciferase
Vector Backbone Description: Backbone Marker:Broad Institute; Backbone Size:8767; Vector Backbone:pLX313; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30224644
Proper citation: RRID:Addgene_118017 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within PRECISE-TBI that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
