Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Pseudomonas fluorescens
Genetic Insert: Mannitol 2-Dehydrogenase from Pseudomonas fluorescens
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5232; Vector Backbone:pET29b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25752240
Proper citation: RRID:Addgene_67730 Copy
Species: Synthetic
Genetic Insert: Kohinoor
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:25894946
Proper citation: RRID:Addgene_67773 Copy
Species: Synthetic
Genetic Insert: HA tag
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR-P2-P3; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27621059
Proper citation: RRID:Addgene_67708 Copy
Species: Other
Genetic Insert: 2A-tdTomato
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pDONR-P2-P3; Vector Types:; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27621059
Comments: Mutation G172S in tdTomato does not affect protein function or fluorescence
Proper citation: RRID:Addgene_67707 Copy
Species: Synthetic
Genetic Insert: Dog Cav1-miniSOG
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26585296
Proper citation: RRID:Addgene_67667 Copy
Species: Homo sapiens
Genetic Insert: Cep123
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23789104
Proper citation: RRID:Addgene_67787 Copy
Species: Synthetic
Genetic Insert: ML1N*2-EGFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26585296
Proper citation: RRID:Addgene_67797 Copy
Species: Homo sapiens
Genetic Insert: V1b receptor
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24248349
Proper citation: RRID:Addgene_67847 Copy
Species: Homo sapiens
Genetic Insert: oxytocin receptor
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24248349
Proper citation: RRID:Addgene_67848 Copy
Species: Homo sapiens
Genetic Insert: antibody 1D8 light kappa chain
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5260; Vector Backbone:modified pET-30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26219832
Proper citation: RRID:Addgene_67843 Copy
Species: Synthetic
Genetic Insert: ECFP(W66A)-FRB-MoA
Vector Backbone Description: Backbone Marker:Clontech; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194
Proper citation: RRID:Addgene_67904 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP1
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Comments: The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”
Proper citation: RRID:Addgene_67869 Copy
Species: Synthetic
Genetic Insert: mCherry-FKBP12
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194
Proper citation: RRID:Addgene_67900 Copy
Species: Synthetic
Genetic Insert: mCherry-FKBP12-DH
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4000; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26435194
Proper citation: RRID:Addgene_67901 Copy
Species: Homo sapiens
Genetic Insert: MRPP3
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23042678
Proper citation: RRID:Addgene_67866 Copy
Species: Homo sapiens
Genetic Insert: HADH2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18984158
Proper citation: RRID:Addgene_67863 Copy
Species: Homo sapiens
Genetic Insert: MRPP3
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18984158
Proper citation: RRID:Addgene_67864 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Proper citation: RRID:Addgene_67870 Copy
Species: Rattus norvegicus
Genetic Insert: Rattus norvegicus aldehyde dehydrogenase
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5232; Vector Backbone:pET29b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_67920 Copy
Species: Mus musculus
Genetic Insert: E-cadherin
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:24652832
Proper citation: RRID:Addgene_67937 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within PRECISE-TBI that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
