Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
PKCa (protein kinase C alpha) antibody Resource Report Resource Website |
Frontier Institute Cat# PKCa-GP, RRID:AB_2571821 | mouse PKCa, 660-672 aa (M25811) | polyclonal | guinea pig | AB_2571821 | Frontier Institute | PKCa-GP | 2026-08-31 05:49:37 | 0 | ||||
|
VDCCa1G (Cav3.1) antibody Resource Report Resource Website |
Frontier Institute Cat# VDCCa1G-GP, RRID:AB_2571853 | mouse VDCCa1G, C-terminal tail (NM_00978) | polyclonal | guinea pig | AB_2571853 | Frontier Institute | VDCCa1G-GP | 2026-08-29 11:16:16 | 0 | ||||
|
GIRK1 (Kir3.1 ; G-protein-coupled inward rectifier potassium channel-1) antibody Resource Report Resource Website 1+ mentions |
Frontier Institute Cat# GIRK1-GP, RRID:AB_2571711 | mouse GIRK1, C-terminal 469-501 aa (D45022) | mouse | polyclonal | guinea pig | AB_2571711 | Frontier Institute | GIRK1-GP | 2026-08-31 09:22:35 | 2 | |||
|
GlyT2 (glycine transporter-2) antibody Resource Report Resource Website 1+ mentions |
Frontier Institute Cat# GlyT2-GP, RRID:AB_2571607 | mouse GlyT2, 1-18 aa (AF411042) | mouse | polyclonal | guinea pig | AB_2571607 | Frontier Institute | GlyT2-GP | 2026-08-31 11:27:35 | 2 | |||
|
D1R (dopamine receptor-1) antibody Resource Report Resource Website 1+ mentions |
Frontier Institute Cat# D1R-GP, RRID:AB_2571595 | mouse dopamine receptor D1 (Drd1), C-terminal 45 aa (NM010076) | mouse | polyclonal | guinea pig | AB_2571595 | Frontier Institute | D1R-GP | 2026-08-29 09:09:24 | 7 | |||
|
DGLa (diacylglycerol lipase-alpha) antibody Resource Report Resource Website |
Frontier Institute Cat# DGLa-GP, RRID:AB_2571693 | mouse DGLa, C-terminal 42 aa (NM198114) | mouse | polyclonal | guinea pig | AB_2571693 | Frontier Institute | DGLa-GP | 2026-08-31 06:37:17 | 0 | |||
|
KChIP3 (potassium voltage-gated channel interacting protein 3) antibody Resource Report Resource Website |
Frontier Institute Cat# KChIP3-GP, RRID:AB_2571650 | rat KChIP3, 239-256aa (NM_032462) | mouse | polyclonal | guinea pig | AB_2571650 | Frontier Institute | KChIP3-GP | 2026-08-29 04:28:26 | 0 | |||
|
GFP (green fluorescent protein) antibody Resource Report Resource Website 1+ mentions |
Frontier Institute Cat# GFP-GP, RRID:AB_2571575 | green fluorescent protein (YP_002302326) | polyclonal | guinea pig | AB_2571575 | Frontier Institute | GFP-GP | 2026-08-28 05:22:01 | 6 | ||||
|
Anti-nNOS Resource Report Resource Website |
Frontier Institute Cat# nNOS-GP, RRID:AB_2571816 | nNOS, C-terminal 15 aa | mouse | Consolidation 4/2022: AB_2571816, AB_2571733 | polyclonal | guinea pig | AB_2571816 | Frontier Institute | nNOS-GP | 2026-08-31 08:37:53 | 0 | ||
|
GAMT (S-adenosylmethionine:guanidinoacetate N-methyltransferase, creatine synthetic enzyme) antibody Resource Report Resource Website |
Frontier Institute Cat# GAMT-GP, RRID:AB_2571700 | mouse GAMT, 1-236 aa (NM010255) | mouse | polyclonal | guinea pig | AB_2571700 | Frontier Institute | GAMT-GP | 2026-08-31 05:49:37 | 0 | |||
|
Anti-IBA 1 Resource Report Resource Website 10+ mentions |
Synaptic Systems Cat# 234 004, RRID:AB_2493179 | IBA 1 | Human, Rat, Zebrafish, Mouse, Sheep | Applications: WB,IP,ICC,IHC,IHC-P | polyclonal | guinea pig | AB_2493179 | Synaptic Systems | 234 004 | 2026-08-31 06:03:21 | 49 | ||
|
Guinea pig polyclonal antibody to human alpha MSH (138-150): Whole serum Resource Report Resource Website |
Biosensis Cat# GP-030-50, RRID:AB_2492389 | A synthetic peptide (Ac-SYSMEHFRWGKPV) corresponding to the amino acids 138-150 from human Proopiomelanocortin (POMC). POMC is the precursor of the melanocortin peptides alpha, beta and gamma. The synthetic peptide was conjugated to a carrier protein to enhance the immunological response. | rat and sheep. Other species have not yet been tested, This antibody is known to react with human | IHC. A concentration of 1 in 2,000 is recommended for IHC. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells. No staining is evident when the primary antibody is pre-absorbed with 0.5mg/ml of alpha MSH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user. | unknown | guinea pig | AB_2492389 | Biosensis | GP-030-50 | 2026-08-29 07:40:01 | 0 | ||
|
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum Resource Report Resource Website |
Biosensis Cat# GP-029-50, RRID:AB_2492388 | A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response. | rat and sheep. Other species have not yet been tested, This antibody is known to react with human | IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user. | unknown | guinea pig | AB_2492388 | Biosensis | GP-029-50 | 2026-08-31 06:03:20 | 0 | ||
|
anti-CTRP5 (human) pAb Resource Report Resource Website |
AdipoGen Cat# AG-25A-0116, RRID:AB_2490433 | CTRP5 | human | Applications: ELISA, IP, WB | polyclonal | guinea pig | AB_2490433 | AdipoGen | AG-25A-0116 | 2026-08-31 10:00:31 | 0 | ||
|
anti-CX3CL1 (human) pAb Resource Report Resource Website |
AdipoGen Cat# AG-25A-0072, RRID:AB_2490386 | CX3CL1 | human | Discontinued; Applications: ELISA, WB | polyclonal | guinea pig | AB_2490386 | AdipoGen | AG-25A-0072 | 2026-08-29 02:32:55 | 0 | ||
|
anti-CTRP1 (human) pAb Resource Report Resource Website |
AdipoGen Cat# AG-25A-0114, RRID:AB_2490431 | CTRP1 | human | Applications: ELISA, IP, WB | polyclonal | guinea pig | AB_2490431 | AdipoGen | AG-25A-0114 | 2026-08-31 01:55:32 | 0 | ||
|
anti-CTRP7 (human) pAb Resource Report Resource Website |
AdipoGen Cat# AG-25A-0117, RRID:AB_2490434 | CTRP7 | human | Applications: ELISA, IP, WB | polyclonal | guinea pig | AB_2490434 | AdipoGen | AG-25A-0117 | 2026-08-31 11:46:35 | 0 | ||
|
anti-CTRP2 (human) pAb Resource Report Resource Website |
AdipoGen Cat# AG-25A-0115, RRID:AB_2490432 | CTRP2 | human | Applications: ELISA, IP, WB | polyclonal | guinea pig | AB_2490432 | AdipoGen | AG-25A-0115 | 2026-08-31 10:27:23 | 0 | ||
|
anti-NMNAT2 (human) pAb Resource Report Resource Website |
AdipoGen Cat# AG-25A-0113, RRID:AB_2490430 | NMNAT2 | human | Applications: ELISA, WB | polyclonal | guinea pig | AB_2490430 | AdipoGen | AG-25A-0113 | 2026-08-31 04:08:06 | 0 | ||
|
Plakophilin 1 antibody Resource Report Resource Website |
Fitzgerald Industries International Cat# 20R-2655, RRID:AB_11197003 | Plakophilin 1 antibody | xenopusamphibian, mouse, frog, bovine | manufacturer recommendations: Western Blot; Immunohistochemistry; IHC, WB | polyclonal | guinea pig | AB_11197003 | Fitzgerald Industries International | 20R-2655 | 2026-08-28 05:06:02 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the PRECISE-TBI Resources search. From here you can search through a compilation of resources used by PRECISE-TBI and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that PRECISE-TBI has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on PRECISE-TBI then you can log in from here to get additional features in PRECISE-TBI such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into PRECISE-TBI you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
