Curator Dashboard

Software suite for image acquisition and analysis. The software can be paired with high-quality cameras to maximize output quality and export it for sharing and research applications.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Total RNA and small/miRNA from TRIzol without phase separation

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

An in vitro qPCR mastermix using SYBR green detection methods to measure DNA amplification and relative expression of genes.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

An in vitro cDNA synthesis kit used for synthesis of single stranded cDNA from whole tissue/embryo RNA

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

An in vitro capped transcription kit used to transcribe open reading frames downstream of SP6 promoter.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

An in vitro transcription kit for capped transcription of open reading frames downstream of T3 promoter.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

The mMESSAGE mMACHINE® T7 Ultra Kit combines a new cap analog, anti-reverse cap analog (ARCA), with a patented high-yield transcription technology to generate RNA transcripts that produce higher protein yields compared to other transcripts upon translation.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

3-aminobenzoic acid ethyl ester methanesulfonate is an anesthetic agent for zebrafish embryos and adults.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

Trizol is a chemical reagent used to extract RNA, DNA and Protein from a single biological sample

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

Latrunculin B is an inhibitor of actin polymerization.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

Nocodazole is a chemical inhibitor of microtubule polymerization.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

A potent chemical inhibitor of TGFbeta type I receptor

• Resource
• RRID-Legacy
• 9 years ago - submitted by Arul Subramanian

Host species：rabbit；Tested applications:Suitable for WB,ICC/IF,IHC-P. Synthetic peptide within Human tenomodulin aa 150-200 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: FEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDF E

• Resource
• SciCrunch
• 9 years ago - submitted by Bing Zhang

Rabbit monoclonal antibody raised against the -Val-Ile-Pro-Arg-Ser in the C-terminus. Edwards et al. Biochem Pharmacol. 1998 Aug 1;56(3):377-87. PubMed PMID: 9744576

• Resource
• SciCrunch
• 9 years ago - submitted by Jonathan Peterson

Software application for data manipulation, calculation and graphical display. Used for statistical computing and graphics and provides a wide variety of statistical (linear and nonlinear modelling, classical statistical tests, time-series analysis, classification, clustering, …) and graphical techniques, and is highly extensible. R provides an Open Source route to participation in statistical methodology. It compiles and runs on a wide variety of UNIX platforms and similar systems (including FreeBSD and Linux), Windows and MacOS.

• Resource
• SciCrunch
• 9 years ago - submitted by Edyta Vieth

long read genome assembler based on hinging HINGE is a genome assembler that seeks to achieve optimal repeat resolution by distinguishing repeats that can be resolved given the data from those that cannot. This is accomplished by adding “hinges” to reads for constructing an overlap graph where only unresolvable repeats are merged. As a result, HINGE combines the error resilience of overlap-based assemblers with repeat-resolution capabilities of de Bruijn graph assemblers.

• Resource
• SciCrunch
• 9 years ago - submitted by Isabella Froman

Software that generates in silico mate-pair reads from single-/paired-end reads of your organism of interest, and a closely related reference genome. It can improve draft genomes by using preferred scaffolding software with the newly created read data. Super-scaffolding of draft genome assemblies with in silico mate-pair libraries derived from (closely) related references.

• Resource
• SciCrunch
• 9 years ago - by Anonymous

SH-SY5Y is a thrice cloned (SK-N-SH -> SH-SY -> SH-SY5 -> SH-SY5Y) subline of the neuroblastoma cell line SK-N-SH (see ATCC HTB-11) which was established in 1970 from a metastatic bone tumor.

• Resource
• SciCrunch
• 9 years ago - submitted by Andrew Lunel

The 293T cell line, originally referred as 293tsA1609neo, is a highly transfectable derivative of human embryonic kidney 293 cells, and contains the SV40 T-antigen.

• SciCrunch
• 9 years ago - submitted by Andrew Lunel

Origin Software from OriginLab:it is the data analysis and graphing software

• Resource
• RRID-Legacy
• 9 years ago - submitted by Edyta Vieth