Curator Dashboard

Consortium that is an independent research initiative of the Human Research Information Network (HIRN). It is developing innovative approaches to model basic aspects of human T1D immunobiology using novel in vivo and in vitro platforms.

• Resource
• dkNET
• 9 years ago - submitted by Ko-Wei Lin

Consortium that is an independent research initiative of the Human Research Information Network (HIRN). It is combining advances in beta cell biology and cell biology with tissue engineering technologies to develop microdevices that support functional human islets.

• Resource
• dkNET
• 9 years ago - submitted by Ko-Wei Lin

Consortium that is an independent research initiative of the Human Research Information Network (HIRN). It is using human tissues to discover highly specific biomarkers of beta cell injury in asymptomatic T1D and developing strategies to stop beta cell destruction early in the disease process.

• Resource
• dkNET
• 9 years ago - submitted by Ko-Wei Lin

Software application for real-time, interactive, multi-camera recording. It is compatible with all Pixelink PL-B and PL-D line of cameras.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Anita Bandrowski

Software that defines a data model for annotated scientific datasets. It includes data together with metadata, and a corresponding file format based on HDF5 for storing and sharing such datasets.

• Resource
• SciCrunch
• 9 years ago - submitted by Thomas Wachtler

Host species：rabbit；Tested applications:Suitable for WB,ICC/IF,IHC-P. Synthetic peptide within Human tenomodulin aa 150-200 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: FEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDF E

• Resource
• SciCrunch
• 9 years ago - submitted by Bing Zhang

THIS RESOURCE IS NO LONGER IN SERVICE. Documented on July 18th, 2023. Software that uses long reads to close gaps in the assemblies.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Software for acquisition and analysis for imaging applications. The acquisition section has a variety of triggering and averaging modes, while the analysis section has extensive provisions for displaying traces (intensity vs time) and movies of propagating activity.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Hardware that is a electrical pulse generator.

• Resource
• SciCrunch
• 9 years ago - by Anonymous

Data acquisition software for TriKinetics activity monitors. TriKinetics systems quantify animal movement over time, and can be used to measure behaviors such as circadian rhythm, sleep, longevity, social interaction, geotaxis, phototaxis, learning, and drug response in various species.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Software for the acquisition, visualization, measurement, and analysis of sounds. Raven supports annotations for research-related analysis.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Software that enables users to digitally edit audio files. GoldWave can record, edit, and analyze audio for research-related purposes.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Database of metabolite structures and annotations. The sources are from multiple existing metabolic and chemical databases such as HMDB, PubChem, CHEBI, BioCyc, and KEGG.

• Resource
• dkNET
• 9 years ago - submitted by Ko-Wei Lin

Imaging and flow cytometry core facility at Johns Hopkins University Homewood Campus.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Justin Brodie-Kommit

Software resource for a data representation for integrative/hybrid methods of modeling macromolecular structures.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Data repository for integrative/hybrid structural models of macromolecules and their assemblies. This includes atomistic models as well as multi-scale models consisting of different coarse-grained representations.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Software for EEG and synchronized video playback and seizure detection based on RMS and line length.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Daniel Lawrence

EEG/EMG, biometric data, and synchronized video recording software.

• Resource
• RRID-Legacy
• 9 years ago - submitted by Daniel Lawrence

Flow cytometry analysis software.

• Resource
• RRID-Legacy
• 9 years ago - by Anonymous

Interactive on line tool where signatures are tagged with user selected metadata and external transcript signatures are projected onto network. Browser to visualize signatures from breast cancer cell lines treated with single molecule perturbations.

• Resource
• SciCrunch
• 9 years ago - submitted by Ko-Wei Lin