URL: http://antibodyregistry.org/AB_2679693
Proper Citation: (Atlas Antibodies Cat# HPA046547, RRID:AB_2679693)
Target Antigen: JAM2
Host Organism: rabbit
Clonality: polyclonal
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEY; Manufacturer approved use: ICC-IF
Expand AllWe found {{ ctrl2.mentions.total_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No alerts have been found for Anti-JAM2 polyclonal antibody.
Source: Antibody Registry