URL: http://antibodyregistry.org/AB_2492388
Proper Citation: (Biosensis Cat# GP-029-50, RRID:AB_2492388)
Target Antigen: A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Host Organism: guinea pig
Clonality: unknown
Comments: IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
Check
for resource mentions.
A list of researchers who have used the resource and an author search tool
Find mentions based on location
{{ ctrl2.mentions.errors.location }}
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum.
No alerts have been found for Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum.
Source: Antibody Registry
