X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Antibody Name

*NOTICE: Multiple vendors found, please select your record:

RRID:AB_10672908 RRID Copied  
PDF Report How to cite
(Atlas Antibodies Cat# HPA037605, RRID:AB_10672908)
Copy Citation Copied
Antibody Information

URL: http://antibodyregistry.org/AB_10672908

Proper Citation: (Atlas Antibodies Cat# HPA037605, RRID:AB_10672908)

Target Antigen: CEP164

Host Organism: rabbit

Clonality: polyclonal

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSG; Manufacturer approved use: IHC

Expand All
Usage and Citation Metrics
We apologize, the data for 2022 is currently unavailable for most resources. We are aware of the issue and are working to resolve it.

We found {{ ctrl2.mentions.total_count }} mentions in open access literature.

We have not found any literature mentions for this resource.

We are searching literature mentions for this resource.

View full usage report

Most recent articles:

{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})

Checkfor all resource mentions.

Collaborator Network

A list of researchers who have used the resource and an author search tool

Find mentions based on location


{{ ctrl2.mentions.errors.location }}

A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.

Ratings and Alerts

No alerts have been found for Anti-CEP164 polyclonal antibody.

View More at BIOMED RESOURCE WATCH

Data and Source Information