X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Antibody Name

*NOTICE: Multiple vendors found, please select your vendor:

RRID:AB_10794515 RRID Copied  
PDF Report Citation
(Atlas Antibodies Cat# HPA041374, RRID:AB_10794515)
Copy Citation Copied
Antibody Information

URL: http://antibodyregistry.org/AB_10794515

Description: This polyclonal antibody targets CCBE1

Antibody Name: Anti-CCBE1 polyclonal antibody

Proper Citation: (Atlas Antibodies Cat# HPA041374, RRID:AB_10794515)

Target Antigen: CCBE1, anti-CCBE1

Target Organism: human, rat, mouse

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRA; Manufacturer approved use: ICC-IF, IHC, WB

Clonality: polyclonal antibody

Host Organism: rabbit

Antibody ID: AB_10794515

Vendor: Atlas Antibodies

Catalog Number: HPA041374

Usage and Citation Metrics

We found {{ ctrl2.mentions.total_count }} mentions in open access literature.
View full usage report

Most recent articles:

{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})

We have not found any literature mentions for this resource.

Checkfor all resource mentions.

Collaborator Network

A list of researchers who have used the resource and an author search tool

Find mentions based on location


{{ ctrl2.mentions.errors.location }}

A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.

Ratings and Alerts

No alerts have been found for Anti-CCBE1 polyclonal antibody.

Data and Source Information