Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pNLF1-N_CRBN:1-442 Resource Report Resource Website |
RRID:Addgene_211066 | CRBN:M1-L442 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. | Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-N_CDC40:1-579 Resource Report Resource Website |
RRID:Addgene_211061 | CDC40:M1-D579 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. | Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-N_DTL:1-730 Resource Report Resource Website |
RRID:Addgene_211060 | DTL:M1-L730 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. | Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-C_RFWD3:1-774 Resource Report Resource Website |
RRID:Addgene_211108 | RFWD3:M1-E774 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xho1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pFBOH-MHL_LRRK2:2141-2527 Resource Report Resource Website 1+ mentions |
RRID:Addgene_210899 | LRRK2:T2141-E2527 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). | Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | M2397T natural variant ( VAR_024965) | 2026-09-12 02:40:21 | 2 |
|
pBiT3.1-N_RFWD3:1-774 Resource Report Resource Website |
RRID:Addgene_211103 | RFWD3:M1-E774 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-N_DTL:1-730 Resource Report Resource Website |
RRID:Addgene_211102 | DTL:M1-L730 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-N_DDB2:1-427 Resource Report Resource Website |
RRID:Addgene_211068 | DDB2:M1-K427 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. | Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-N_BTRC:1-605 Resource Report Resource Website |
RRID:Addgene_211101 | BTRC:M1-R605 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-C_CSNK2A2:1-350 Resource Report Resource Website |
RRID:Addgene_211081 | CSNK2A2:M1-R350 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. | Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-C_FBXL2:1-423 Resource Report Resource Website |
RRID:Addgene_211078 | FBXL2:M1-L423 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. | Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-N_FBXL2:1-423 Resource Report Resource Website |
RRID:Addgene_211077 | FBXL2:M1-L423 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. | Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-N_RACK1:1-317 Resource Report Resource Website |
RRID:Addgene_211110 | RACK1:M1-R317 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pHTN-HaloTag_LEO1:1-666 Resource Report Resource Website |
RRID:Addgene_211073 | LEO1:M1-D666 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: maeigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnpervkgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisgepttedlyfqsdnaiasef. | Backbone Marker:Promega; Vector Backbone:pHTN-HaloTag; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pHTC-HaloTag_FBXO3:1-471 Resource Report Resource Website |
RRID:Addgene_211072 | FBXO3:M1-F471 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xho1 (not destroyed). C terminal tag: lepttedlyfqsdndgseigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnpervkgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisg. | Backbone Marker:Promega; Vector Backbone:pHTC-HaloTag; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-N_WDR82:1-313 Resource Report Resource Website |
RRID:Addgene_211117 | WDR82:M1-D313 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:22 | 0 |
|
pBiT3.1-N_SMU1:1-513 Resource Report Resource Website |
RRID:Addgene_211114 | SMU1:M1-P513 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-C_EIF4A2:1-407 Resource Report Resource Website |
RRID:Addgene_211092 | EIF4A2:M1-I407 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. | Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-C_PRKCSH:1-527 Resource Report Resource Website |
RRID:Addgene_211091 | PRKCSH:M1-L527 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. | Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 333-333: missing. A291T natural variant (VAR_028762) | 2026-09-12 02:40:21 | 0 |
|
pNLF1-C_PML:1-781 Resource Report Resource Website |
RRID:Addgene_211090 | PML:M1-L781 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. | Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | isoform 13 . E224D annotated sequence conflict. S724G G732V not annotated | 2026-09-12 02:40:21 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the Kravitz Resources search. From here you can search through a compilation of resources used by Kravitz and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that Kravitz has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on Kravitz then you can log in from here to get additional features in Kravitz such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into Kravitz you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The data sets included in this resource are published in Kravitz et al, 2012. Distinct roles for direct and indirect pathway striatal neurons in reinforcement (Nat. Neurosci).
