Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Facets


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

742,581 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pNLF1-N_CRBN:1-442
 
Resource Report
Resource Website
RRID:Addgene_211066 CRBN:M1-L442 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pNLF1-N_CDC40:1-579
 
Resource Report
Resource Website
RRID:Addgene_211061 CDC40:M1-D579 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pNLF1-N_DTL:1-730
 
Resource Report
Resource Website
RRID:Addgene_211060 DTL:M1-L730 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pBiT3.1-C_RFWD3:1-774
 
Resource Report
Resource Website
RRID:Addgene_211108 RFWD3:M1-E774 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xho1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:21 0
pFBOH-MHL_LRRK2:2141-2527
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_210899 LRRK2:T2141-E2527 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin M2397T natural variant ( VAR_024965) 2026-09-12 02:40:21 2
pBiT3.1-N_RFWD3:1-774
 
Resource Report
Resource Website
RRID:Addgene_211103 RFWD3:M1-E774 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:21 0
pBiT3.1-N_DTL:1-730
 
Resource Report
Resource Website
RRID:Addgene_211102 DTL:M1-L730 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:21 0
pNLF1-N_DDB2:1-427
 
Resource Report
Resource Website
RRID:Addgene_211068 DDB2:M1-K427 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pBiT3.1-N_BTRC:1-605
 
Resource Report
Resource Website
RRID:Addgene_211101 BTRC:M1-R605 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:21 0
pNLF1-C_CSNK2A2:1-350
 
Resource Report
Resource Website
RRID:Addgene_211081 CSNK2A2:M1-R350 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pNLF1-C_FBXL2:1-423
 
Resource Report
Resource Website
RRID:Addgene_211078 FBXL2:M1-L423 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pNLF1-N_FBXL2:1-423
 
Resource Report
Resource Website
RRID:Addgene_211077 FBXL2:M1-L423 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pBiT3.1-N_RACK1:1-317
 
Resource Report
Resource Website
RRID:Addgene_211110 RACK1:M1-R317 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:21 0
pHTN-HaloTag_LEO1:1-666
 
Resource Report
Resource Website
RRID:Addgene_211073 LEO1:M1-D666 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: maeigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnpervkgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisgepttedlyfqsdnaiasef. Backbone Marker:Promega; Vector Backbone:pHTN-HaloTag; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pHTC-HaloTag_FBXO3:1-471
 
Resource Report
Resource Website
RRID:Addgene_211072 FBXO3:M1-F471 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xho1 (not destroyed). C terminal tag: lepttedlyfqsdndgseigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnpervkgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisg. Backbone Marker:Promega; Vector Backbone:pHTC-HaloTag; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pBiT3.1-N_WDR82:1-313
 
Resource Report
Resource Website
RRID:Addgene_211117 WDR82:M1-D313 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:22 0
pBiT3.1-N_SMU1:1-513
 
Resource Report
Resource Website
RRID:Addgene_211114 SMU1:M1-P513 Homo sapiens Kanamycin PMID:39495097 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin wild type 2026-09-12 02:40:21 0
pNLF1-C_EIF4A2:1-407
 
Resource Report
Resource Website
RRID:Addgene_211092 EIF4A2:M1-I407 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin wild type 2026-09-12 02:40:21 0
pNLF1-C_PRKCSH:1-527
 
Resource Report
Resource Website
RRID:Addgene_211091 PRKCSH:M1-L527 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 333-333: missing. A291T natural variant (VAR_028762) 2026-09-12 02:40:21 0
pNLF1-C_PML:1-781
 
Resource Report
Resource Website
RRID:Addgene_211090 PML:M1-L781 Homo sapiens Ampicillin PMID:39495097 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin isoform 13 . E224D annotated sequence conflict. S724G G732V not annotated 2026-09-12 02:40:21 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. Kravitz Dataset1 Resources

    Welcome to the Kravitz Resources search. From here you can search through a compilation of resources used by Kravitz and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that Kravitz has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on Kravitz then you can log in from here to get additional features in Kravitz such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into Kravitz you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.