Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: MCL1 apoptosis regulator, BCL2 family member
Vector Backbone Description: Backbone Marker:GeneCopoeia; Vector Backbone:pLV-Neo-CMV; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37410869
Proper citation: RRID:Addgene_202668 Copy
Species: Homo sapiens
Genetic Insert: Spastin aa 43-92
Vector Backbone Description: Vector Backbone:mApple-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:38949658
Proper citation: RRID:Addgene_214409 Copy
Species: Mus musculus
Genetic Insert: anti-Kv1.1 K+ channel (Rattus norvegicus) recombinant Mouse monoclonal antibody
Vector Backbone Description: Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2b; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37758930
Comments: This is a recombinant antibody derived from RRID: AB_2941194. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute
Proper citation: RRID:Addgene_206623 Copy
Species: Mus musculus
Genetic Insert: anti-Kvbeta2 K+ channel (Mus musculus) recombinant Mouse monoclonal antibody
Vector Backbone Description: Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2b; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37758930
Comments: This is a recombinant antibody derived from RRID: AB_2941193. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute
Proper citation: RRID:Addgene_206622 Copy
Species: Homo sapiens
Genetic Insert: MCL1 apoptosis regulator, BCL2 family member
Vector Backbone Description: Vector Backbone:pLVx-TetOne-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37410869
Proper citation: RRID:Addgene_202663 Copy
Species: Homo sapiens
Genetic Insert: BCL9 transcription coactivator
Vector Backbone Description: Vector Backbone:pLVx-TetOne-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37410869
Proper citation: RRID:Addgene_202662 Copy
Species: Mus musculus
Genetic Insert: anti-Kv9.2 K+ channel (Mus musculus) recombinant Mouse monoclonal antibody
Vector Backbone Description: Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2a; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:37758930
Comments: This is a recombinant antibody derived from RRID: AB_2941165. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute
Proper citation: RRID:Addgene_206591 Copy
Species: Escherichia coli
Genetic Insert: eaeA
Vector Backbone Description: Backbone Marker:IBA Lifescience; Backbone Size:2826; Vector Backbone:pASK-IBA2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38478271
Proper citation: RRID:Addgene_198039 Copy
Species: Escherichia coli
Genetic Insert: eaeA
Vector Backbone Description: Backbone Marker:IBA Lifescience; Backbone Size:3286; Vector Backbone:pASK-IBA2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:38478271
Proper citation: RRID:Addgene_198038 Copy
Species: Homo sapiens
Genetic Insert: WDR70:M1-I654
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed).
Proper citation: RRID:Addgene_211143 Copy
Species: Homo sapiens
Genetic Insert: NEDD1:M1-F660
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed).
Proper citation: RRID:Addgene_211140 Copy
Species: Homo sapiens
Genetic Insert: DCAF11:M1-Q546
Vector Backbone Description: Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed).
Proper citation: RRID:Addgene_210907 Copy
Species: Homo sapiens
Genetic Insert: AAMP:D82-R434
Vector Backbone Description: Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed).
Proper citation: RRID:Addgene_210904 Copy
Species: Homo sapiens
Genetic Insert: DDA1:M1-T102
Vector Backbone Description: Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-LIC; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed).
Proper citation: RRID:Addgene_210902 Copy
Species: Homo sapiens
Genetic Insert: DCAF8L2:G207-L550
Vector Backbone Description: Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed).
Proper citation: RRID:Addgene_210913 Copy
Species: Homo sapiens
Genetic Insert: CSTF1:G80-D431
Vector Backbone Description: Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed).
Proper citation: RRID:Addgene_210912 Copy
Species: Homo sapiens
Genetic Insert: CDC20:M1-R499
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef.
Proper citation: RRID:Addgene_211058 Copy
Species: Homo sapiens
Genetic Insert: PRPF4:M1-E522
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed).
Proper citation: RRID:Addgene_211109 Copy
Species: Homo sapiens
Genetic Insert: CRBN:M1-L442
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila.
Proper citation: RRID:Addgene_211067 Copy
Species: Homo sapiens
Genetic Insert: FBXW11:M1-R542
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:39495097
Comments: 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed).
Proper citation: RRID:Addgene_211100 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the Kravitz Resources search. From here you can search through a compilation of resources used by Kravitz and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that Kravitz has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on Kravitz then you can log in from here to get additional features in Kravitz such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into Kravitz you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within Kravitz that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The data sets included in this resource are published in Kravitz et al, 2012. Distinct roles for direct and indirect pathway striatal neurons in reinforcement (Nat. Neurosci).
