Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pLVX-Neo-CMV-MCL1 Resource Report Resource Website |
RRID:Addgene_202668 | MCL1 apoptosis regulator, BCL2 family member | Homo sapiens | Ampicillin | PMID:37410869 | Backbone Marker:GeneCopoeia; Vector Backbone:pLV-Neo-CMV; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-09-12 02:40:20 | 0 | ||
|
mApple-1xHp Resource Report Resource Website |
RRID:Addgene_214409 | Spastin aa 43-92 | Homo sapiens | Kanamycin | PMID:38949658 | Vector Backbone:mApple-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-09-12 02:40:20 | 0 | ||
|
Anti-Kv1.1 K+ channel [K20/78R-2b] Resource Report Resource Website |
RRID:Addgene_206623 | anti-Kv1.1 K+ channel (Rattus norvegicus) recombinant Mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:37758930 | This is a recombinant antibody derived from RRID: AB_2941194. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute | Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2b; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:40:20 | 0 | |
|
Anti-Kvbeta2 K+ channel [K17/70R-2b] Resource Report Resource Website |
RRID:Addgene_206622 | anti-Kvbeta2 K+ channel (Mus musculus) recombinant Mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:37758930 | This is a recombinant antibody derived from RRID: AB_2941193. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute | Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2b; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:40:20 | 0 | |
|
pLVX-TetOne-Puro-MCL1 Resource Report Resource Website |
RRID:Addgene_202663 | MCL1 apoptosis regulator, BCL2 family member | Homo sapiens | Ampicillin | PMID:37410869 | Vector Backbone:pLVx-TetOne-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-09-12 02:40:20 | 0 | ||
|
pLVX-TetOne-Puro-BCL9 Resource Report Resource Website |
RRID:Addgene_202662 | BCL9 transcription coactivator | Homo sapiens | Ampicillin | PMID:37410869 | Vector Backbone:pLVx-TetOne-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2026-09-12 02:40:20 | 0 | ||
|
Anti-Kv9.2 K+ channel [N460/19R] Resource Report Resource Website |
RRID:Addgene_206591 | anti-Kv9.2 K+ channel (Mus musculus) recombinant Mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:37758930 | This is a recombinant antibody derived from RRID: AB_2941165. Isotype: IgG2a. A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute | Backbone Marker:Gavin Wright, Sanger; Yves Durocher, NRCC; Backbone Size:5925; Vector Backbone:P1316-IgG2a; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:40:20 | 0 | |
|
pIBA2-IntHA453-SpyTag Resource Report Resource Website |
RRID:Addgene_198039 | eaeA | Escherichia coli | Ampicillin | PMID:38478271 | Backbone Marker:IBA Lifescience; Backbone Size:2826; Vector Backbone:pASK-IBA2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | double HA tag inserted at position 453; lacks native signal peptide (amino acids 1-39) | 2026-09-12 02:40:20 | 0 | |
|
pIBA2-Int-SpyTag Resource Report Resource Website |
RRID:Addgene_198038 | eaeA | Escherichia coli | Ampicillin | PMID:38478271 | Backbone Marker:IBA Lifescience; Backbone Size:3286; Vector Backbone:pASK-IBA2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | lacks native signal peptide (amino acids 1-39) | 2026-09-12 02:40:20 | 0 | |
|
pBiT3.1-N_WDR70:1-654 Resource Report Resource Website |
RRID:Addgene_211143 | WDR70:M1-I654 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:22 | 0 |
|
pBiT3.1-N_NEDD1:1-660 Resource Report Resource Website |
RRID:Addgene_211140 | NEDD1:M1-F660 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:22 | 0 |
|
pFBOH-MHL_DCAF11:1-546 Resource Report Resource Website |
RRID:Addgene_210907 | DCAF11:M1-Q546 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). | Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | R207H natural variant (VAR_020121) | 2026-09-12 02:40:21 | 0 |
|
pFBOH-MHL_AAMP:82-434 Resource Report Resource Website |
RRID:Addgene_210904 | AAMP:D82-R434 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). | Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pFBOH-LIC_DDA1:1-102 Resource Report Resource Website |
RRID:Addgene_210902 | DDA1:M1-T102 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). | Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-LIC; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pFBOH-MHL_DCAF8L2:207-550 Resource Report Resource Website |
RRID:Addgene_210913 | DCAF8L2:G207-L550 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). | Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pFBOH-MHL_CSTF1:80-431 Resource Report Resource Website |
RRID:Addgene_210912 | CSTF1:G80-D431 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). | Backbone Marker:pFASTBac1 Modified; Vector Backbone:pFBOH-MHL; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-N_CDC20:1-499 Resource Report Resource Website |
RRID:Addgene_211058 | CDC20:M1-R499 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef. | Backbone Marker:Promega; Vector Backbone:pNLF1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-N_PRPF4:1-522 Resource Report Resource Website |
RRID:Addgene_211109 | PRPF4:M1-E522 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
|
pNLF1-C_CRBN:1-442 Resource Report Resource Website |
RRID:Addgene_211067 | CRBN:M1-L442 | Homo sapiens | Ampicillin | PMID:39495097 | 5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). C terminal tag: srfgpnscrralgssgvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerila. | Backbone Marker:Promega; Vector Backbone:pNLF1-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | wild type | 2026-09-12 02:40:21 | 0 |
|
pBiT3.1-N_FBXW11:1-542 Resource Report Resource Website |
RRID:Addgene_211100 | FBXW11:M1-R542 | Homo sapiens | Kanamycin | PMID:39495097 | 5' Cloning Site: Xho1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). | Backbone Marker:Promega; Vector Backbone:pBiT3.1-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | wild type | 2026-09-12 02:40:21 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the Kravitz Resources search. From here you can search through a compilation of resources used by Kravitz and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that Kravitz has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on Kravitz then you can log in from here to get additional features in Kravitz such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into Kravitz you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The data sets included in this resource are published in Kravitz et al, 2012. Distinct roles for direct and indirect pathway striatal neurons in reinforcement (Nat. Neurosci).
