Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Saccharomyces cerevisiae
Genetic Insert: snR14
Vector Backbone Description: Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:7585243
Comments: for in vitro transcription from T7 promoter
Proper citation: RRID:Addgene_111336 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: CWC25
Vector Backbone Description: Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_111339 Copy
Species: Homo sapiens
Genetic Insert: RNAi against human Protection of Telomeres 1
Vector Backbone Description: Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15620654
Comments: Target sequence is: TACCT CGCAC TTCAA GCAA.
Proper citation: RRID:Addgene_11133 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: PRP39
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24231520
Proper citation: RRID:Addgene_111286 Copy
Species: Homo sapiens
Genetic Insert: RNAi vector for human protection of telomeres 1(control for 1660)
Vector Backbone Description: Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15620654
Comments: Plasmid contains the 1660 sequence (GTACT AGAAG CCTAT CTCA), but is not a hairpin.
Proper citation: RRID:Addgene_11132 Copy
Species: Homo sapiens
Genetic Insert: RNAi vector for human protection of telomeres 1(control for 344)
Vector Backbone Description: Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15620654
Comments: Plasmid contains the 344 sequence (TACCT CGCAC TTCAA GCAA), but is not a hairpin.
Proper citation: RRID:Addgene_11134 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: ACT1
Vector Backbone Description: Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16103217
Comments: for use in in vitro splicing reactions
Proper citation: RRID:Addgene_111323 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: PRP40
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:24231520
Proper citation: RRID:Addgene_111287 Copy
Species: Homo sapiens
Genetic Insert: human CLYBL ( aa23-340) codon optimized for bacterial expression
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pET30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29056341
Proper citation: RRID:Addgene_111288 Copy
Species: Homo sapiens
Genetic Insert: c-myc, HRas
Vector Backbone Description: Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16267004
Comments: Contains mouse c-myc and human Hras. This plasmid was generated by cloning c-MycT58A cDNA with flanking BamHI-EcoRI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site H-RasG12V cDNA in which HindIII/ClaI sites were again added by PCR.
Proper citation: RRID:Addgene_11130 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574
Proper citation: RRID:Addgene_111321 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: ACT1
Vector Backbone Description: Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16103217
Comments: for use in in vitro splicing reactions
Proper citation: RRID:Addgene_111326 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: ACT1
Vector Backbone Description: Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16103217
Comments: for use in in vitro splicing reactions
Proper citation: RRID:Addgene_111325 Copy
Species: Mus musculus
Genetic Insert: murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG
Proper citation: RRID:Addgene_111274 Copy
Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
Proper citation: RRID:Addgene_111272 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574
Proper citation: RRID:Addgene_111311 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574
Comments: There is an additional mutation in snu114 E910G- Not sure if this affects plasmid function.
Proper citation: RRID:Addgene_111315 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574
Proper citation: RRID:Addgene_111316 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574
Proper citation: RRID:Addgene_111314 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574
Comments: A single myc epitope was placed immediately after the start codon of SNU114 by inserting the annealed oligos oKD140 (5′-AATTCCCAGAACAAAAATTGATTTCTGAAGAAGATTTGAATA-3′) and oKD141 (5′-GATCTATTCAAATCTTCTTCAGAAATCAATTTTTGTTCTGGG-3′), which have overhanging EcoRI/BglII sites, into the same sites of pTB4. The resulting plasmid was named pTB19.
Proper citation: RRID:Addgene_111317 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the Kravitz Resources search. From here you can search through a compilation of resources used by Kravitz and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that Kravitz has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on Kravitz then you can log in from here to get additional features in Kravitz such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into Kravitz you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within Kravitz that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The data sets included in this resource are published in Kravitz et al, 2012. Distinct roles for direct and indirect pathway striatal neurons in reinforcement (Nat. Neurosci).
