Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 102 showing 2021 ~ 2040 out of 742,877 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection

http://www.addgene.org/111151

Species: Mus musculus
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_111151 Copy   


  • RRID:Addgene_111152

    This resource has 1+ mentions.

http://www.addgene.org/111152

Species: Xenopus laevis
Genetic Insert: TFPnls-T2a-mErt-Cre-Ert
Vector Backbone Description: Vector Backbone:Sce based vector; Vector Types:Cre/Lox; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_111152 Copy   


  • RRID:Addgene_111156

    This resource has 1+ mentions.

http://www.addgene.org/111156

Species: Homo sapiens
Genetic Insert: hShh
Vector Backbone Description: Vector Backbone:pOEM1; Vector Types:Mammalian Expression, Insect Expression, Baculoviral rescue shuttle vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27120163

Proper citation: RRID:Addgene_111156 Copy   


http://www.addgene.org/111159

Species: Ambystoma mexicanum
Genetic Insert: axFgf8
Vector Backbone Description: Vector Backbone:pOEM1; Vector Types:Mammalian Expression, Insect Expression, Baculoviral rescue shuttle vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27120163

Proper citation: RRID:Addgene_111159 Copy   


http://www.addgene.org/111260

Species: Synthetic
Genetic Insert: DsRed-Express2
Vector Backbone Description: Backbone Marker:Herbert Schweizer; Vector Backbone:pUC18T-mini-Tn7T; Vector Types:Bacterial Expression; Bacterial Resistance:Gentamicin
Defining Citation: PMID:29449848
Comments: Please note that Addgene NGS results identified a 963T>A mutation in first FRT site compared to the depositing lab's sequence. The effect of this variant on FLP recombination efficiency is unknown.

Proper citation: RRID:Addgene_111260 Copy   


http://www.addgene.org/111267

Species: Homo sapiens
Genetic Insert: potassium voltage-gated channel subfamily KQT member 5 isoform 1 [Homo sapiens]
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pET28; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29429937

Proper citation: RRID:Addgene_111267 Copy   


  • RRID:Addgene_111268

http://www.addgene.org/111268

Species: Synthetic
Genetic Insert: PP7-mVenus
Vector Backbone Description: Vector Backbone:pNEB193; Vector Types:Mammalian Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29343869

Proper citation: RRID:Addgene_111268 Copy   


  • RRID:Addgene_111269

    This resource has 1+ mentions.

http://www.addgene.org/111269

Species: Mus musculus
Genetic Insert: murine Syk tandem SH2 domains (Ser 8 to Gln 264), the unphosphorylated form
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26468009
Comments: encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ

Proper citation: RRID:Addgene_111269 Copy   


  • RRID:Addgene_111302

http://www.addgene.org/111302

Species: Saccharomyces cerevisiae
Genetic Insert: SUB2
Vector Backbone Description: Backbone Size:6018; Vector Backbone:pRS315; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11156604

Proper citation: RRID:Addgene_111302 Copy   


  • RRID:Addgene_111303

http://www.addgene.org/111303

Species: Saccharomyces cerevisiae
Genetic Insert: PRP5
Vector Backbone Description: Backbone Size:7950; Vector Backbone:yCP50; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:8722763
Comments: Full plasmid sequence contains several ambiguous bases in the backbone- Unsure if these regions will affect function.

Proper citation: RRID:Addgene_111303 Copy   


  • RRID:Addgene_111308

http://www.addgene.org/111308

Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4887; Vector Backbone:pRS316; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574

Proper citation: RRID:Addgene_111308 Copy   


  • RRID:Addgene_111309

http://www.addgene.org/111309

Species: Saccharomyces cerevisiae
Genetic Insert: SNU114
Vector Backbone Description: Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15911574

Proper citation: RRID:Addgene_111309 Copy   


  • RRID:Addgene_111306

http://www.addgene.org/111306

Species: Saccharomyces cerevisiae
Genetic Insert: PRP8
Vector Backbone Description: Vector Backbone:pRS303; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:8725222
Comments: Please note PRP8 has a G1801D mutation- unsure if this affects protein function.

Proper citation: RRID:Addgene_111306 Copy   


  • RRID:Addgene_11128

    This resource has 1+ mentions.

http://www.addgene.org/11128

Species: Homo sapiens
Genetic Insert: hTERT, p53 dominant negative
Vector Backbone Description: Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:16267004
Comments: This plasmid was generated by cloning FLAG-hTERT cDNA with flanking EcoRI-SalI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site p53DD cDNA in which HindIII/ClaI sites were again added by PCR.

Proper citation: RRID:Addgene_11128 Copy   


  • RRID:Addgene_111252

    This resource has 1+ mentions.

http://www.addgene.org/111252

Species: Synthetic
Genetic Insert: E2-Crimson
Vector Backbone Description: Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:29449848

Proper citation: RRID:Addgene_111252 Copy   


  • RRID:Addgene_111253

http://www.addgene.org/111253

Species: Synthetic
Genetic Insert: TorA signal peptide
Vector Backbone Description: Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:29449848

Proper citation: RRID:Addgene_111253 Copy   


http://www.addgene.org/11124

Species: Homo sapiens
Genetic Insert: RalA WT
Vector Backbone Description: Backbone Size:5100; Vector Backbone:pWZLblast; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15950903

Proper citation: RRID:Addgene_11124 Copy   


http://www.addgene.org/111251

Species: Synthetic
Genetic Insert: DsRed-Express2
Vector Backbone Description: Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:29449848

Proper citation: RRID:Addgene_111251 Copy   


http://www.addgene.org/111257

Species: Synthetic
Genetic Insert: DsRed-Express2
Vector Backbone Description: Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:29449848

Proper citation: RRID:Addgene_111257 Copy   


http://www.addgene.org/111254

Species: Synthetic
Genetic Insert: TorA(sp)-mTurquoise2
Vector Backbone Description: Backbone Marker:Dieter Haas; obtained from Culture Collection of Switzerland; Vector Backbone:pME6031; Vector Types:Bacterial Expression; Bacterial Resistance:Tetracycline
Defining Citation: PMID:29449848

Proper citation: RRID:Addgene_111254 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. Kravitz Dataset1 Resources

    Welcome to the Kravitz Resources search. From here you can search through a compilation of resources used by Kravitz and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that Kravitz has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on Kravitz then you can log in from here to get additional features in Kravitz such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into Kravitz you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within Kravitz that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X