Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-OR2D3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA052551, RRID:AB_2681867 | OR2D3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681867 | Atlas Antibodies | HPA052551 | 2025-08-19 10:32:13 | 0 | ||
|
Anti-AC092329.1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA042724, RRID:AB_10793983 | AC092329.1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10793983 | Sigma-Aldrich | HPA042724 | 2025-08-19 10:32:10 | 0 | ||
|
Anti-TBC1D3L polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA052553, RRID:AB_2681869 | TBC1D3L | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681869 | Atlas Antibodies | HPA052553 | 2025-08-19 10:32:13 | 0 | ||
|
Anti-CFAP77 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 | CFAP77 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10601126 | Atlas Antibodies | HPA024647 | 2025-08-19 10:32:11 | 0 | ||
|
Anti-CMC2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 | CMC2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845581 | Atlas Antibodies | HPA006871 | 2025-08-19 10:32:11 | 0 | ||
|
Anti-CAV3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA054488, RRID:AB_2682504 | CAV3 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682504 | Atlas Antibodies | HPA054488 | 2025-08-19 10:32:14 | 0 | ||
|
Anti-TCF12 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA002103, RRID:AB_1080230 | Human TCF12 | human | Vendor recommendations: | unknown | rabbit | AB_1080230 | Sigma-Aldrich | HPA002103 | 2025-08-19 10:32:30 | 0 | ||
|
RBPJ-human Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# WH0003516M1, RRID:AB_1843301 | RBPJ | homo sapiens | Clone 4E12 | ENCODE PROJECT External validation DATA SET is released testing lot 08248-4E12 for any cell type or tissues; status is awaiting lab characterization | monoclonal | mouse | AB_1843301 | Sigma-Aldrich | WH0003516M1 | 2025-08-19 10:32:12 | 0 | |
|
Anti-ABHD3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA010729, RRID:AB_1844449 | Human ABHD3 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1844449 | Sigma-Aldrich | HPA010729 | 2025-08-19 10:32:39 | 0 | ||
|
Anti-LAMTOR3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA026858, RRID:AB_1853523 | LAMTOR3 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1853523 | Sigma-Aldrich | HPA026858 | 2025-08-19 10:25:50 | 0 | ||
|
Anti-TSSC1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA031231, RRID:AB_10669881 | TSSC1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10669881 | Sigma-Aldrich | HPA031231 | 2025-08-19 10:26:07 | 0 | ||
|
PYGO2-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX119726, RRID:AB_10618352 | PYGO2 | rat, mouse, human | ENCODE PROJECT External validation DATA SET is released testing lot 40807 for not specified; status is not pursued | polyclonal | rabbit | AB_10618352 | GeneTex | GTX119726 | 2025-08-19 10:25:58 | 0 | ||
|
Anti-PAFAH1B3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA035639, RRID:AB_10670163 | PAFAH1B3 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10670163 | Sigma-Aldrich | HPA035639 | 2025-08-19 10:26:04 | 0 | ||
|
Anti-ZBTB8B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA028690, RRID:AB_10600897 | ZBTB8B antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10600897 | Sigma-Aldrich | HPA028690 | 2025-08-19 10:25:57 | 0 | ||
|
Anti-PARD3B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA035283, RRID:AB_10671102 | PARD3B antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10671102 | Sigma-Aldrich | HPA035283 | 2025-08-19 10:26:04 | 0 | ||
|
Anti-HS6ST2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA034625, RRID:AB_10612119 | HS6ST2 antibody produced in rabbit | human | Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10612119 | Sigma-Aldrich | HPA034625 | 2025-08-19 10:26:08 | 0 | ||
|
Anti-ZNF274 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA028880, RRID:AB_10601929 | ZNF274 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10601929 | Sigma-Aldrich | HPA028880 | 2025-08-19 10:26:08 | 0 | ||
|
Anti-KCND3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA029452, RRID:AB_10602239 | KCND3 antibody produced in rabbit | human | Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10602239 | Sigma-Aldrich | HPA029452 | 2025-08-19 10:26:08 | 0 | ||
|
Anti-BAZ1A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA002730, RRID:AB_1078269 | Human BAZ1A | human | Vendor recommendations: | unknown | rabbit | AB_1078269 | Sigma-Aldrich | HPA002730 | 2025-08-19 10:26:11 | 0 | ||
|
Anti-NUDT22 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA039334, RRID:AB_10795174 | NUDT22 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10795174 | Sigma-Aldrich | HPA039334 | 2025-08-19 10:26:19 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the ASWG Resources search. From here you can search through a compilation of resources used by ASWG and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that ASWG has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on ASWG then you can log in from here to get additional features in ASWG such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into ASWG you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the ASWG Community.
Our Information
