URL: http://www.addgene.org/26974
Proper Citation: RRID:Addgene_26974
Insert Name: Lck-GCaMP3
Bacterial Resistance: Kanamycin
Defining Citation: PMID:21205365
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3950; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Sequence is identical to pN1-Lck-GCaMP2 http://www.addgene.org/24794 , except for three mutations in GCaMP2 to make GCaMP3: M153K (EGFP); T203V (EGFP) and N60D (CaM). Note that the RSET tag refers to the first 37 amino acids of the insert, which include the His tag, T7 tag and Xpress tag: MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVD A genetically targeted optical sensor to monitor calcium signals in astrocyte processes. Shigetomi E., et al. Nat. Neurosci. 2010 Jun;13(6):759-66.
Expand AllWe found {{ ctrl2.mentions.total_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
Check
for all resource mentions.
A list of researchers who have used the resource and an author search tool
Find mentions based on location
{{ ctrl2.mentions.errors.location }}
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for pN1-Lck-GCaMP3.
No alerts have been found for pN1-Lck-GCaMP3.
Source: Addgene