Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pLZ31 (pCFJ151_Peft-3_TIR1_linker_mRuby_unc-54 3'UTR) Resource Report Resource Website 1+ mentions |
RRID:Addgene_71720 | TRANSPORT INHIBITOR RESPONSE 1 | Arabidopsis thaliana | Ampicillin | PMID:26552885 | Please note: eft-3 has officially been changed to eef-1A.1 Please see the eef-1A.1 WormBase entry for details: http://www.wormbase.org/species/c_elegans/gene/WBGene00001168#05-9g-3 | Backbone Size:7373; Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin | codon-optimized for expression in C. elegans; Two point mutations D170E and M473L incorporated | 2026-08-29 01:09:45 | 9 |
|
pLZ29 (pCFJ151_Peft-3_degron_EmGFP_unc-54 3'UTR) Resource Report Resource Website 1+ mentions |
RRID:Addgene_71719 | auxin-responsive protein IAA17 | Arabidopsis thaliana | Ampicillin | PMID:26552885 | Please note: eft-3 has officially been changed to eef-1A.1 Please see the eef-1A.1 WormBase entry for details: http://www.wormbase.org/species/c_elegans/gene/WBGene00001168#05-9g-3 | Backbone Size:7373; Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin | minimal degron sequence (71-114aa) with start codon | 2026-08-29 01:09:45 | 4 |
|
CRY2(L348F)-CreN Resource Report Resource Website 1+ mentions |
RRID:Addgene_75368 | CRY2 | Arabidopsis thaliana | Kanamycin | PMID:27065233 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:mCherryC1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | L348F | 2026-08-29 01:10:20 | 3 | |
|
CIB1-CreC(N1) Resource Report Resource Website 1+ mentions |
RRID:Addgene_75367 | CIB1 | Arabidopsis thaliana | Kanamycin | PMID:27065233 | Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:mCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:10:21 | 3 | ||
|
pU6-1 (GB1204) Resource Report Resource Website |
RRID:Addgene_75405 | AtU6-1 promoter | Arabidopsis thaliana | Chloramphenicol | PMID:26839579 | Backbone Marker:self-made; derived from the BioBrick assembly plasmid pSB1C3 ; Backbone Size:2105; Vector Backbone:pUPD2; Vector Types:Plant Expression, CRISPR, Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2026-08-29 01:10:21 | 0 | ||
|
Gal4BD-CRY2(535) Resource Report Resource Website |
RRID:Addgene_75369 | CRY2 | Arabidopsis thaliana | Kanamycin | PMID:27065233 | Vector Backbone:pDBTrp; Vector Types:Yeast Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:10:20 | 0 | ||
|
Cry2 mcherry Gamma 9 in pcDNA3.1 Resource Report Resource Website |
RRID:Addgene_64208 | Cry2 | Arabidopsis thaliana | Ampicillin | PMID:24920824 | Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:08:41 | 0 | ||
|
Cry2 mCherry RGS4(del 1-33) in pcDNA3.1
Resource Report Resource Website 1+ mentions |
RRID:Addgene_64207 | Cry2 | Arabidopsis thaliana | Ampicillin | PMID:24920824 | Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:08:41 | 1 | ||
|
Cry2 mCherry PGK-1 in pcDNA3.1 Resource Report Resource Website |
RRID:Addgene_64214 | Cry2 PHR | Arabidopsis thaliana | Ampicillin | PMID:24920824 | PGK1 is cloned within the KpnI and XbaI sites | Backbone Marker:Invitrogen; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:08:41 | 0 | |
|
pETM6-At4CL-CmCHS-CmCHI Resource Report Resource Website |
RRID:Addgene_73395 | At4CL | Arabidopsis thaliana | Ampicillin | PMID:26860871 | Backbone Marker:Koffas Lab, Addgene Plasmid #49795; Backbone Size:5203; Vector Backbone:pETM6; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:10:02 | 0 | ||
|
pETM6-At4CL-PhCHS-CmCHI Resource Report Resource Website |
RRID:Addgene_73393 | At4CL | Arabidopsis thaliana | Ampicillin | PMID:26860871 | Backbone Marker:Koffas Lab, Addgene Plasmid #49795; Backbone Size:5203; Vector Backbone:pETM6; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:10:02 | 0 | ||
|
pVP2A-PIF6 Resource Report Resource Website 1+ mentions |
RRID:Addgene_73369 | PIF6 | Arabidopsis thaliana | Ampicillin | PMID:26618393 | Please note that there are some discrepancies between Addgene's quality control sequences and the depositor's sequence. The depositor noted that these discrepancies do NOT affect plasmid function. | Backbone Size:7282; Vector Backbone:pRepCap; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:10:02 | 1 | |
|
pETM6-At4CL-PhCHS-CmCHI (C5 mutant, pFlavo-opt) Resource Report Resource Website 1+ mentions |
RRID:Addgene_73404 | At4CL | Arabidopsis thaliana | Ampicillin | PMID:26860871 | Identical to pETM6-At4CL-PhCHS-CmCHI above except that the CmCHI gene is expressed from the ePathOptimize C4 (mutant T7) promoter. | Backbone Marker:Koffas Lab, Addgene Plasmid #49795; Backbone Size:5203; Vector Backbone:pETM6; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:10:02 | 1 | |
|
pEG03 Resource Report Resource Website |
RRID:Addgene_73841 | PhyB(1-917) with C-term his tag | Arabidopsis thaliana | Ampicillin | PMID:26618393 | Backbone Marker:Dictybase (http://dictybase.org/) ; Backbone Size:6213; Vector Backbone:pNO001; Vector Types:Dictyostelium discoideum expression; Bacterial Resistance:Ampicillin | 2026-08-29 01:10:06 | 0 | ||
|
pET28-At_PRORP1-His Resource Report Resource Website |
RRID:Addgene_67869 | PRORP1 | Arabidopsis thaliana | Kanamycin | PMID:22976545 | The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG” | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | Residues 36-572 (see comments) | 2026-08-29 01:09:12 | 0 |
|
pMAL-PIAL2M-wt Resource Report Resource Website |
RRID:Addgene_67909 | PIAL2 | Arabidopsis thaliana | Ampicillin | PMID:25415977 | Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | E281-A496 | 2026-08-29 01:09:12 | 0 | |
|
pABD823 Resource Report Resource Website |
RRID:Addgene_67911 | Cold temperature germinating 10 (CTG10) | Arabidopsis thaliana | Chloramphenicol | PMID:29632208 | Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol | 2026-08-29 01:09:12 | 0 | ||
|
pET28-At_PRORP2-His Resource Report Resource Website |
RRID:Addgene_67870 | PRORP2 | Arabidopsis thaliana | Kanamycin | PMID:22976545 | Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-29 01:09:12 | 0 | ||
|
pICSL11062 Resource Report Resource Website |
RRID:Addgene_68256 | Promoter_AtU6-26 + sgRNA_BolC.GA4a-2 | Arabidopsis thaliana | Ampicillin | PMID:26616834 | Target sequence: GTTGAGAGGGGAGCCGGTGA | Vector Backbone:pICH47761 (AddGene #48003); Vector Types:Plant Expression, Synthetic Biology; Bacterial Resistance:Ampicillin | 2026-08-29 01:09:15 | 0 | |
|
pICSL90002 Resource Report Resource Website 1+ mentions |
RRID:Addgene_68261 | Promoter: U6-26 (Arabidopsis thaliana) | Arabidopsis thaliana | Spectinomycin | PMID:26616834 | Vector Backbone:pAGM9121; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin | 2026-08-29 01:09:15 | 6 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the nidm-terms Resources search. From here you can search through a compilation of resources used by nidm-terms and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that nidm-terms has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on nidm-terms then you can log in from here to get additional features in nidm-terms such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into nidm-terms you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
