Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: TRANSPORT INHIBITOR RESPONSE 1
Vector Backbone Description: Backbone Size:7373; Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26552885
Comments: Please note: eft-3 has officially been changed to eef-1A.1 Please see the eef-1A.1 WormBase entry for details: http://www.wormbase.org/species/c_elegans/gene/WBGene00001168#05-9g-3
Proper citation: RRID:Addgene_71720 Copy
Species: Arabidopsis thaliana
Genetic Insert: auxin-responsive protein IAA17
Vector Backbone Description: Backbone Size:7373; Vector Backbone:pCFJ151; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26552885
Comments: Please note: eft-3 has officially been changed to eef-1A.1 Please see the eef-1A.1 WormBase entry for details: http://www.wormbase.org/species/c_elegans/gene/WBGene00001168#05-9g-3
Proper citation: RRID:Addgene_71719 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP1
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Comments: The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”
Proper citation: RRID:Addgene_67869 Copy
Species: Arabidopsis thaliana
Genetic Insert: PIAL2
Vector Backbone Description: Backbone Marker:NEB; Backbone Size:6700; Vector Backbone:pMAL-c2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25415977
Proper citation: RRID:Addgene_67909 Copy
Species: Arabidopsis thaliana
Genetic Insert: Cold temperature germinating 10 (CTG10)
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:6494; Vector Backbone:pBD-GAL4 Cam; Vector Types:Yeast Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29632208
Proper citation: RRID:Addgene_67911 Copy
Species: Arabidopsis thaliana
Genetic Insert: PRORP2
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5369; Vector Backbone:pET28-b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:22976545
Proper citation: RRID:Addgene_67870 Copy
Species: Arabidopsis thaliana
Genetic Insert: guide RNA targeting AtPDS3
Vector Backbone Description: Backbone Size:3162; Vector Backbone:pUC119; Vector Types:CRISPR, Plant expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23929339
Comments: gRNA target sequence GGACTTTTGCCAGCCATGGT
This plasmid is used as a PCR template to assemble new desired guide RNA according to the strategy published in Figure S5 of our Nature Biotechnology paper.
Proper citation: RRID:Addgene_52255 Copy
Species: Arabidopsis thaliana
Genetic Insert: zep
Vector Backbone Description: Backbone Marker:Francis X. Cunningham, Jr.; Backbone Size:10040; Vector Backbone:pAC-ZEAXipi; Vector Types:low copy number bacterial cloning vector; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:24506237
Comments: For better yield of low copy number pAC-based plasmids, grow liquid cultures on a platform shaker at ca. 30 degrees Celsius. When cultures reach early stationary phase, dilute 2-fold with growth medium, add spectinomycin (150 mg/liter), and "amplify" for several hours before harvest. For plasmid selection and maintenance in E. coli, use chloramphenicol at 30 mg/liter.
Proper citation: RRID:Addgene_53087 Copy
Species: Arabidopsis thaliana
Genetic Insert: lcyE
Vector Backbone Description: Backbone Marker:Francis X. Cunningham, Jr.; Backbone Size:9476; Vector Backbone:pAC-LYC; Vector Types:low copy number bacterial cloning vector; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:8798688
Comments: For better yield of low copy number pAC-based plasmids, grow liquid cultures on a platform shaker at ca. 30 degrees Celsius. When cultures reach early stationary phase, dilute 2-fold with growth medium, add spectinomycin (150 mg/liter), and "amplify" for several hours before harvest. For plasmid selection and maintenance in E. coli, use chloramphenicol at 30 mg/liter.
Proper citation: RRID:Addgene_53273 Copy
Species: Arabidopsis thaliana
Genetic Insert: chyB1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4414; Vector Backbone:pTrcHis A; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15659105
Proper citation: RRID:Addgene_53367 Copy
Species: Arabidopsis thaliana
Genetic Insert: UBQ10 promoter
Vector Backbone Description: Backbone Marker:Mark Curtis at ETH Zurich (Brand et al., Plant Physiology 2006); Vector Backbone:pLB12; Vector Types:Other, plant expression; Bacterial Resistance:Spectinomycin
Comments: The vector pLB12 contains both an activator unit and a b-glucuronidase (GUS) reporter within a responder unit.
Proper citation: RRID:Addgene_53449 Copy
Species: Arabidopsis thaliana
Genetic Insert: lcyB
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:2958; Vector Backbone:pBluescript SK-; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:17085635
Proper citation: RRID:Addgene_53588 Copy
Species: Arabidopsis thaliana
Genetic Insert: lcyE
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:2958; Vector Backbone:pBluescript SK-; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:8837512
Proper citation: RRID:Addgene_53586 Copy
Species: Arabidopsis thaliana
Genetic Insert: At4CL
Vector Backbone Description: Backbone Marker:Koffas Lab, Addgene Plasmid #49795; Backbone Size:5203; Vector Backbone:pETM6; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26860871
Proper citation: RRID:Addgene_73395 Copy
Species: Arabidopsis thaliana
Genetic Insert: At4CL
Vector Backbone Description: Backbone Marker:Koffas Lab, Addgene Plasmid #49795; Backbone Size:5203; Vector Backbone:pETM6; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26860871
Proper citation: RRID:Addgene_73393 Copy
Species: Arabidopsis thaliana
Genetic Insert: PIF6
Vector Backbone Description: Backbone Size:7282; Vector Backbone:pRepCap; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26618393
Comments: Please note that there are some discrepancies between Addgene's quality control sequences and the depositor's sequence. The depositor noted that these discrepancies do NOT affect plasmid function.
Proper citation: RRID:Addgene_73369 Copy
Species: Arabidopsis thaliana
Genetic Insert: At4CL
Vector Backbone Description: Backbone Marker:Koffas Lab, Addgene Plasmid #49795; Backbone Size:5203; Vector Backbone:pETM6; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26860871
Comments: Identical to pETM6-At4CL-PhCHS-CmCHI above except that the CmCHI gene is expressed from the ePathOptimize C4 (mutant T7) promoter.
Proper citation: RRID:Addgene_73404 Copy
Species: Arabidopsis thaliana
Genetic Insert: PhyB(1-917) with C-term his tag
Vector Backbone Description: Backbone Marker:Dictybase (http://dictybase.org/) ; Backbone Size:6213; Vector Backbone:pNO001; Vector Types:Dictyostelium discoideum expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26618393
Proper citation: RRID:Addgene_73841 Copy
Species: Arabidopsis thaliana
Genetic Insert: CUC2
Vector Backbone Description: Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64805 Copy
Species: Arabidopsis thaliana
Genetic Insert: TCP4
Vector Backbone Description: Vector Backbone:pGADT7; Vector Types:; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25448000
Proper citation: RRID:Addgene_64807 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the nidm-terms Resources search. From here you can search through a compilation of resources used by nidm-terms and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that nidm-terms has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on nidm-terms then you can log in from here to get additional features in nidm-terms such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into nidm-terms you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within nidm-terms that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
