Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Authority:addgene (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

178,636 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pHH0103 NEDD4 WW domain #1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104208 NEDD4 WW domain #1 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDN Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 1
pHH0103 NEDD4L WW domain #4
 
Resource Report
Resource Website 		RRID:Addgene_104207 NEDD4L WW domain #4 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNP Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 0
pHH0103 NEDD4L WW domain #1
 
Resource Report
Resource Website 		RRID:Addgene_104204 NEDD4L WW domain #1 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDV Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 0
pHH0103 NEDD4L WW domain #3
 
Resource Report
Resource Website 		RRID:Addgene_104206 NEDD4L WW domain #3 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFP Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 0
CRY2(neutral2-6)-mCherry
 
Resource Report
Resource Website 		RRID:Addgene_104181 CRY2(neutral2-6)-mCherry Arabidopsis thaliana Kanamycin PMID:28916751 Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin CRY2PHR K2S M3S D4G K5S K6S 2026-09-01 09:10:17 0
LentiRCas9-CUG
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104183 U6-CUGsgRNA, EFS-PIN-dCas9 Ampicillin PMID:28803727 Vector Backbone:LentiCRISPR v2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 1
CRY2low-tdTomato-Raf1
 
Resource Report
Resource Website 		RRID:Addgene_104176 CRY2low-tdTomato-Raf1 Homo sapiens Kanamycin PMID:28916751 Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin CRY2 aa 1-491 truncation, R489E A491D 2026-09-01 09:10:17 0
pHH0103 WWP2 WW domain #4
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104215 WWP2 WW domain #4 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 1
pHH0103 WWP2 WW domain #3
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104214 WWP2 WW domain #3 Homo sapiens Ampicillin Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin codon optimized for expression in bacteria 2026-09-01 09:10:18 1
PAJ426
 
Resource Report
Resource Website 		RRID:Addgene_104145 Kanamycin PMID:33095053 Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 0
PAJ407
 
Resource Report
Resource Website 		RRID:Addgene_104144 Kanamycin PMID:33095053 Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 0
PAJ389
 
Resource Report
Resource Website 		RRID:Addgene_104147 Chloramphenicol PMID:33095053 Backbone Size:9550; Vector Backbone:p15A; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Chloramphenicol 2026-09-01 09:10:17 0
pSF4 TetCMV 5'TOP intron Renilla-STOP 24xPP7 1xfirefly-siRNA xrRNA12 24xMS2 SV40 CTE polyA
 
Resource Report
Resource Website 		RRID:Addgene_104140 Renilla luciferase Renilla reniformis Ampicillin PMID:29056324 Vector Backbone:pSF4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 0
PAJ379
 
Resource Report
Resource Website 		RRID:Addgene_104143 Kanamycin PMID:33095053 Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 0
pGL3-BASIC- ARHGAP29 Mutant PROMOTER
 
Resource Report
Resource Website 		RRID:Addgene_104156 ARHGAP29 promoter Homo sapiens Ampicillin PMID:28538170 Vector Backbone:pGL3 basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin delete two TEAD binding sites 2026-09-01 09:10:17 0
pTP1112
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104158 Anti-mouse IgG1 Fc specific nanobody TP1107 (1xCysteine) Vicugna pacos Kanamycin PMID:29263082 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 5
pTP943
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104157 Anti-mouse IgG1 Fab specific nanobody TP886 Vicugna pacos Kanamycin PMID:29263082 Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-09-01 09:10:17 3
pcDNA3.1-HA-ARHGAP29
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_104154 ARHGAP29 Homo sapiens Ampicillin PMID:28538170 Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-09-01 09:10:17 3
pNGVL4a-hCRTmE6mE7mL2
 
Resource Report
Resource Website 		RRID:Addgene_104153 hCRTmE6mE7mL2 11-210 Homo sapiens Kanamycin PMID:28515303 Vector Backbone:pNGVL4a; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin residues 11 to 200 of the late protein L2 2026-09-01 09:10:17 0
Mouse CRISPRi sgRNA library Dolomiti in backbone XPR_050, Set B
 
Resource Report
Resource Website 		RRID:Addgene_104091 Ampicillin PMID:30575746 Vector Backbone:XPR_050; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin 2026-09-01 09:10:16 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. NIDM Terminology Resources

    Welcome to the nidm-terms Resources search. From here you can search through a compilation of resources used by nidm-terms and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that nidm-terms has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on nidm-terms then you can log in from here to get additional features in nidm-terms such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into nidm-terms you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

NIDM Terminology

Recent News Entries

Contact Us

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch