Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
Proper citation: RRID:Addgene_104215 Copy
Species: Homo sapiens
Genetic Insert: WWP2 WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI
Proper citation: RRID:Addgene_104214 Copy
Species: Escherichia coli str. K-12 substr. MG1655
Genetic Insert: OmpR
Vector Backbone Description: Vector Backbone:ColE1; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29650958
Proper citation: RRID:Addgene_104335 Copy
Species: Homo sapiens
Genetic Insert: DRP2 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - LSSSVQVPWERAISPNKVPYYINHQAQTTCWDHPKMTEL
Proper citation: RRID:Addgene_104270 Copy
Species: Homo sapiens
Genetic Insert: BAG3 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPS
Proper citation: RRID:Addgene_104266 Copy
Species: Homo sapiens
Genetic Insert: CEP164 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - AAPGEWKPCQDITGDIYYFNFAHGQSMWDHPCDAAA
Proper citation: RRID:Addgene_104300 Copy
Species: Homo sapiens
Genetic Insert: FNBP4 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGEE
Proper citation: RRID:Addgene_104264 Copy
Species: Other
Genetic Insert: LifeAct-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024
Proper citation: RRID:Addgene_104307 Copy
Species: Homo sapiens
Genetic Insert: YAP WW1 domain
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-2TK; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: The human WW domain in this plasmid was obtained from cDNA described in the following reference:
Sudol M et al. J Biol Chem. 1995 Jun 16;270(24):14733-41. https://www.ncbi.nlm.nih.gov/pubmed/7782338
Please see the following references for additional information regarding the WW domain of human YAP:
1. Chen HI and Sudol M. Proc Natl Acad Sci U S A. 1995 Aug 15;92(17):7819-23. https://www.ncbi.nlm.nih.gov/pubmed/7644498
2. Toepert F et al., Angew Chem Int Ed Engl. 2001 Mar 2;40(5):897-900. https://www.ncbi.nlm.nih.gov/pubmed/11241639
Proper citation: RRID:Addgene_104306 Copy
Species: Other
Genetic Insert: mito-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024
Proper citation: RRID:Addgene_104309 Copy
Species: Other
Genetic Insert: LifeAct-mGarnet2
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28044150
Proper citation: RRID:Addgene_104308 Copy
Species: Homo sapiens
Genetic Insert: PIN1L WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNS
Proper citation: RRID:Addgene_104269 Copy
Species: Homo sapiens
Genetic Insert: TCERG1L WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - STPVPGSPWCVVWTGDDRVFFFNPTMHLSVWEKPMDLKD
Proper citation: RRID:Addgene_104281 Copy
Species: Homo sapiens
Genetic Insert: KIAA1688 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PGSNTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
Proper citation: RRID:Addgene_104277 Copy
Species: Homo sapiens
Genetic Insert: IQGAP1 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - AVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQ
Proper citation: RRID:Addgene_104279 Copy
Species: Homo sapiens
Genetic Insert: KIAA1688 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - KRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDI
Proper citation: RRID:Addgene_104278 Copy
Species: Other
Genetic Insert: H2B-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024
Proper citation: RRID:Addgene_104311 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRD
Proper citation: RRID:Addgene_104274 Copy
Species: Other
Genetic Insert: alpha-actinin-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26648024
Proper citation: RRID:Addgene_104315 Copy
Species: Homo sapiens
Genetic Insert: MAGI1 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - SELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAK
Proper citation: RRID:Addgene_104243 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.