Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 28 showing 541 ~ 560 out of 742,581 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_104104

    This resource has 1+ mentions.

http://www.addgene.org/104104

Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Backbone Marker:Stratagene; Vector Backbone:pBluescript SK(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104104 Copy   


  • RRID:Addgene_104112

    This resource has 1+ mentions.

http://www.addgene.org/104112

Species: Discosoma sp.
Genetic Insert: tdTomato
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104112 Copy   


  • RRID:Addgene_104111

    This resource has 1+ mentions.

http://www.addgene.org/104111

Species: Aequorea victoria
Genetic Insert: EYFP
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104111 Copy   


  • RRID:Addgene_104199

http://www.addgene.org/104199

Species: Homo sapiens
Genetic Insert: human androgen receptor aa 4-52
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15684378

Proper citation: RRID:Addgene_104199 Copy   


http://www.addgene.org/104114

Species: Synthetic
Genetic Insert: CheRiff-CFP
Vector Backbone Description: Backbone Size:9000; Vector Backbone:fCAG-FLEX; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587

Proper citation: RRID:Addgene_104114 Copy   


  • RRID:Addgene_104195

http://www.addgene.org/104195

Species: Homo sapiens
Genetic Insert: human androgen receptor aa 1-566
Vector Backbone Description: Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:10816582
Comments: The GST-AR insert has an insertion of 3 glutamine residues at amino acid 74 and a deletion of six amino acids (GGGGGE) after amino acid 466 compared to the listed reference sequence. The depositor has confirmed that this should not affect plasmid function.

Proper citation: RRID:Addgene_104195 Copy   


  • RRID:Addgene_104110

    This resource has 1+ mentions.

http://www.addgene.org/104110

Species: Aequorea victoria
Genetic Insert: mTurquoise2
Vector Backbone Description: Vector Backbone:AAV2; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30454553

Proper citation: RRID:Addgene_104110 Copy   


  • RRID:Addgene_104076

http://www.addgene.org/104076

Species: Rattus norvegicus
Genetic Insert: KCC2 (b isoform)
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4807; Vector Backbone:EGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28785725
Comments: In order to directly visualize the insertion of KCC2 IGE variants into the membranes of single neurons, we created a novel construct encoding KCC2 with a pHluorine tag introduced into the second extracellular loop of the transporter , KCC2-pHex. See attached Scheme of KCC2-ext.pdf

Proper citation: RRID:Addgene_104076 Copy   


http://www.addgene.org/104119

Species: Synthetic
Genetic Insert: CheRiff-CFP
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pAAV-hsyn-cre-off; Vector Types:Mammalian Expression, Adenoviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587

Proper citation: RRID:Addgene_104119 Copy   


http://www.addgene.org/104115

Species: Synthetic
Genetic Insert: somCheRiff-CFP
Vector Backbone Description: Backbone Size:9982; Vector Backbone:fCAG cre-on; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30275587

Proper citation: RRID:Addgene_104115 Copy   


http://www.addgene.org/104293

Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNAS

Proper citation: RRID:Addgene_104293 Copy   


http://www.addgene.org/104288

Species: Homo sapiens
Genetic Insert: KIAA0082 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - IVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSI

Proper citation: RRID:Addgene_104288 Copy   


http://www.addgene.org/104287

Species: Homo sapiens
Genetic Insert: PQBP1 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - RLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPN

Proper citation: RRID:Addgene_104287 Copy   


  • RRID:Addgene_104208

    This resource has 1+ mentions.

http://www.addgene.org/104208

Species: Homo sapiens
Genetic Insert: NEDD4 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDN

Proper citation: RRID:Addgene_104208 Copy   


http://www.addgene.org/104207

Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNP

Proper citation: RRID:Addgene_104207 Copy   


http://www.addgene.org/104206

Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFP

Proper citation: RRID:Addgene_104206 Copy   


  • RRID:Addgene_104333

http://www.addgene.org/104333

Species: Synthetic
Genetic Insert: Taz
Vector Backbone Description: Vector Backbone:p15a; Vector Types:Bacterial Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:29650958

Proper citation: RRID:Addgene_104333 Copy   


http://www.addgene.org/104297

Species: Homo sapiens
Genetic Insert: HLA-DQA2 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFI

Proper citation: RRID:Addgene_104297 Copy   


  • RRID:Addgene_104330

    This resource has 1+ mentions.

http://www.addgene.org/104330

Genetic Insert: TVA-mCherry fusion protein
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV, Adeno Associated Viral Vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28689641

Proper citation: RRID:Addgene_104330 Copy   


http://www.addgene.org/104219

Species: Homo sapiens
Genetic Insert: ITCH WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - NEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS

Proper citation: RRID:Addgene_104219 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within kravitz2 that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X