Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: human androgen receptor aa 624-919
Vector Backbone Description: Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12612084
Proper citation: RRID:Addgene_104200 Copy
Species: Vicugna pacos
Genetic Insert: Anti-GFP nanobody Enhancer PDB 3K1K (1x Cysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26633879
Proper citation: RRID:Addgene_104166 Copy
Species: Homo sapiens
Genetic Insert: human androgen receptor aa 400-449
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_104201 Copy
Species: Vicugna pacos
Genetic Insert: Anti-rabbit IgG Fc specific nanobody TP897 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104163 Copy
Species: Vicugna pacos
Genetic Insert: Anti-mouse kappa chain specific nanobody TP1170 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104162 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDV
Proper citation: RRID:Addgene_104204 Copy
Species: Arabidopsis thaliana
Genetic Insert: CRY2(neutral2-6)-mCherry
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28916751
Proper citation: RRID:Addgene_104181 Copy
Genetic Insert: U6-CUGsgRNA, EFS-PIN-dCas9
Vector Backbone Description: Vector Backbone:LentiCRISPR v2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28803727
Proper citation: RRID:Addgene_104183 Copy
Species: Other
Genetic Insert: GFP
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Comments: Please visit https://www.biorxiv.org/content/early/2018/01/19/246405 for bioRxiv preprint.
Proper citation: RRID:Addgene_104061 Copy
Species: Other
Genetic Insert: EYFP-f
Vector Backbone Description: Backbone Size:4745; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Comments: Please visit https://www.biorxiv.org/content/early/2018/01/19/246405 for bioRxiv preprint.
Proper citation: RRID:Addgene_104057 Copy
Species: Homo sapiens
Genetic Insert: CRY2low-tdTomato-Raf1
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28916751
Proper citation: RRID:Addgene_104176 Copy
Species: Other
Genetic Insert: 2xNLS-tdTomato
Vector Backbone Description: Backbone Size:6023; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Comments: Please visit https://www.biorxiv.org/content/early/2018/01/19/246405 for bioRxiv preprint.
Proper citation: RRID:Addgene_104054 Copy
Vector Backbone Description: Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33095053
Proper citation: RRID:Addgene_104145 Copy
Vector Backbone Description: Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33095053
Proper citation: RRID:Addgene_104144 Copy
Vector Backbone Description: Backbone Size:9550; Vector Backbone:p15A; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:33095053
Proper citation: RRID:Addgene_104147 Copy
Species: Renilla reniformis
Genetic Insert: Renilla luciferase
Vector Backbone Description: Vector Backbone:pSF4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29056324
Proper citation: RRID:Addgene_104140 Copy
Vector Backbone Description: Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33095053
Proper citation: RRID:Addgene_104143 Copy
Species: Homo sapiens
Genetic Insert: ARHGAP29 promoter
Vector Backbone Description: Vector Backbone:pGL3 basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28538170
Proper citation: RRID:Addgene_104156 Copy
Species: Vicugna pacos
Genetic Insert: Anti-mouse IgG1 Fc specific nanobody TP1107 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104158 Copy
Species: Vicugna pacos
Genetic Insert: Anti-mouse IgG1 Fab specific nanobody TP886
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082
Proper citation: RRID:Addgene_104157 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.