Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
On page 210 showing 4181 ~ 4200 out of 739,718 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

http://www.addgene.org/16277

Species: Homo sapiens
Genetic Insert: hTRF1
Vector Backbone Description: Backbone Size:5900; Vector Backbone:pWZL Hygro NFLAG; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12169636

Proper citation: RRID:Addgene_16277 Copy   

http://www.addgene.org/16274

Species: Gallus gallus
Genetic Insert: ER81
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9814709
Comments: To make an antisense probe, cut with NotI and transcribe with T7.

Proper citation: RRID:Addgene_16274 Copy   

http://www.addgene.org/16273

Species: Gallus gallus
Genetic Insert: islet1
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript SK; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: To make a sense probe, cut with XhoI and transcribe with T3. To make an antisense probe, cut with NotI transcribe with T7.

Proper citation: RRID:Addgene_16273 Copy   

http://www.addgene.org/16272

Species: Mus musculus
Genetic Insert: GDF7
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript KS; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: To make a sense probe, cut with XbaI and transcribe with T3. To make an antisense probe, cut with EcoRI and transcribe with T7.

Proper citation: RRID:Addgene_16272 Copy   

    • RRID:Addgene_162844

http://www.addgene.org/162844

Species: Synthetic
Genetic Insert: 4_1_RNA-device
Vector Backbone Description: Backbone Marker:https://doi.org/10.1093/nar/gks636; Backbone Size:8187; Vector Backbone:pCS1748; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33915105

Proper citation: RRID:Addgene_162844 Copy   

http://www.addgene.org/162918

Species: Synthetic
Genetic Insert: firefly luciferase/green fluorescent protein fusion with upstream IRES sequence
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162918 Copy   

http://www.addgene.org/162917

Species: Synthetic
Genetic Insert: SV40 polyadenylation sequence
Vector Backbone Description: Vector Backbone:pDonr257; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162917 Copy   

http://www.addgene.org/162919

Species: Synthetic
Genetic Insert: firefly luciferase with upstream IRES sequence
Vector Backbone Description: Vector Backbone:pDonr257; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162919 Copy   

http://www.addgene.org/162910

Species: Synthetic
Genetic Insert: FLAG epitope tag
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162910 Copy   

http://www.addgene.org/162911

Species: Synthetic
Genetic Insert: HA epitope tag
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162911 Copy   

http://www.addgene.org/162914

Species: Synthetic
Genetic Insert: SNAP tag
Vector Backbone Description: Vector Backbone:pDonr257; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162914 Copy   

http://www.addgene.org/162907

Species: Synthetic
Genetic Insert: monomeric Ruby3 fluorescent protein
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162907 Copy   

http://www.addgene.org/162909

Species: Synthetic
Genetic Insert: V5 epitope tag
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162909 Copy   

http://www.addgene.org/162901

Species: Synthetic
Genetic Insert: Nanoluciferase
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162901 Copy   

    • RRID:Addgene_162869

http://www.addgene.org/162869

Species: Synthetic
Genetic Insert: 4_1m_RNA-device
Vector Backbone Description: Backbone Marker:https://doi.org/10.1093/nar/gks636; Backbone Size:8187; Vector Backbone:pCS1748; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33915105

Proper citation: RRID:Addgene_162869 Copy   

http://www.addgene.org/162902

Species: Synthetic
Genetic Insert: monomeric enhanced Green fluorescent protein
Vector Backbone Description: Vector Backbone:pDonr234; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162902 Copy   

    • RRID:Addgene_162891

http://www.addgene.org/162891

Species: Synthetic
Genetic Insert: Nanoluciferase
Vector Backbone Description: Vector Backbone:pDonr253; Vector Types:Synthetic Biology; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:24395366

Proper citation: RRID:Addgene_162891 Copy   

http://www.addgene.org/16283

Species: Mus musculus
Genetic Insert: HB9 promoter
Vector Backbone Description: Backbone Size:3000; Vector Backbone:pBluescript; Vector Types:Mammalian Expression, Mouse Targeting; Bacterial Resistance:Ampicillin
Defining Citation: PMID:15958737

Proper citation: RRID:Addgene_16283 Copy   

http://www.addgene.org/162817

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF6
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2)

Proper citation: RRID:Addgene_162817 Copy   

http://www.addgene.org/162816

Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_9b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2)

Proper citation: RRID:Addgene_162816 Copy   

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X

  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within kravitz2 that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."

Recent News Entries

Kravitz Dataset 2

Contact Us

E [email protected]

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch