Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

739,423 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pAG253
 
Resource Report
Resource Website 		RRID:Addgene_33208 RAP1A Homo sapiens Ampicillin PMID:21909094 Backbone Marker:Addgene plasmid #12177; Backbone Size:3745; Vector Backbone:pIS2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-07-25 12:45:57 0
pCS252
 
Resource Report
Resource Website 		RRID:Addgene_33207 MAP4K4 3'UTR Homo sapiens Ampicillin PMID:21909094 Backbone Marker:Addgene plasmid #12177; Backbone Size:3745; Vector Backbone:pIS2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin miR-CGCG sites: aaCgCga, aaCgCgaa 2026-07-25 12:45:57 0
pAC-Cyc
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33156 Cyc Drosophila melanogaster Ampicillin PMID:18494558 Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His A; Vector Types:Insect Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-07-25 12:45:57 1
pAC-Luc
 
Resource Report
Resource Website 		RRID:Addgene_33154 Ampicillin PMID:17578907 Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His B; Vector Types:Insect Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-07-25 12:45:57 0
pDMG1b
 
Resource Report
Resource Website 		RRID:Addgene_33159 cog-1 3'UTR Caenorhabditis elegans Ampicillin PMID:21909094 Backbone Marker:Addgene (#12179); Backbone Size:4085; Vector Backbone:pIS1; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin miR-142 sites: aCacTaCa, aCacTaCa 2026-07-25 12:45:57 0
pMXs-mGLIS1
 
Resource Report
Resource Website 		RRID:Addgene_33273 GLIS1, Gateway casette A Mus musculus Ampicillin PMID:21654807 Backbone Marker:Dr. Toshio Kitamura; Backbone Size:4700; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-07-25 12:45:57 0
pAC-dCLK
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33153 CLK Drosophila melanogaster Ampicillin PMID:11158307 Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His B; Vector Types:Insect Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-07-25 12:45:57 1
pLG-Nde-Acc
 
Resource Report
Resource Website 		RRID:Addgene_33150 RP51A-synthetic minimal intron Saccharomyces cerevisiae Ampicillin PMID:2655924 Original intron sequence: GTATGTTAATATGGTTAACGTCGACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG Vector Backbone:pLGSD5; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin AccI site in intron was cut/filled/ligated to change GTCGAC to GTCGCGAC, and NdeI site after intron was cut/filled and a BamHI linker was inserted to obtain the appropriate reading frame changing CATATG to CATACGGGATCC 2026-07-25 12:45:57 0
pLG-deltaA
 
Resource Report
Resource Website 		RRID:Addgene_33151 RP51A-synthetic minimal intron Saccharomyces cerevisiae Ampicillin PMID:2655924 Original intron sequence: GTATGTTAATATGGTTAACGTCGACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG Modified intron sequence: GACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG Vector Backbone:pLGSD5; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin The RP51A sequence was modified by digestion with StyI and HincII, filled in and ligated to delete ~27bp including the 5' splice site 2026-07-25 12:45:57 0
pT7-L2-M3T3D
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33300 L2 Orthoreovirus T3D Ampicillin PMID:20042210 Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 2
pT7-L1-M2T1L
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33303 L1 Orthoreovirus T1L Ampicillin PMID:20042210 Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 2
pT7-L2-M3T1L
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33304 L2 Orthoreovirus T1L Ampicillin PMID:20042210 Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 1
pT7-M2-S2-S3-S4T3D
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33302 S2 Orthoreovirus T3D Ampicillin PMID:20042210 Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 2
pJMK001
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33780 Proteorhodopsin Optical Proton Sensor uncultured proteobacterium EBAC31A08 Ampicillin PMID:21764748 Backbone Marker:Invitrogen; Backbone Size:4127; Vector Backbone:pBAD TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin D97N 2026-07-25 12:45:59 3
Ubc.Luc.IRES.Puro
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33307 Firefly Luciferase firefly Ampicillin PMID:21439256 Backbone Marker:David Baltimore; Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 5
cEF.tk-GFP
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33308 HSV-TK/GFP Ampicillin PMID:19114988 Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 3
pcDNA3.1-mETV3
 
Resource Report
Resource Website 		RRID:Addgene_33374 Etv3 Mus musculus Ampicillin PMID:18025162 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 0
pcDNA3.1-mETV3-HA
 
Resource Report
Resource Website 		RRID:Addgene_33375 Etv3 Mus musculus Ampicillin PMID:18025162 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:58 0
EcMBP165-cpGFP.PPYF.T203V.pRSET
 
Resource Report
Resource Website 		RRID:Addgene_33373 Improved MBP based Maltose Biosensor E. coli Ampicillin PMID:21989929 The GFP-T203V mutation decreases the fluorescence emission of the apo state and increases that of the saturated state in GCaMP2. In the context of MBP165-cpGFP.PPYF, the T203V mutation decreases the fluorescence emission of the apo state by half, whereas saturated fluorescence and affinity are unchanged, increasing ΔF/F to 6.5. Backbone Marker:Invitrogen; Backbone Size:2300; Vector Backbone:pRSET-A; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin cpGFP146 variant from GCaMP2 inserted between AA165-166 of MBP with T203V mutation in GFP. 2026-07-25 12:45:58 0
CMV500 A-CREB
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_33371 CREB Mus musculus Ampicillin PMID:9447994 A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein. Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Dominant Negative (see notes) 2026-07-25 12:45:58 5

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."

Recent News Entries

Kravitz Dataset 2

Contact Us

E [email protected]

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch