Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: RAP1A
Vector Backbone Description: Backbone Marker:Addgene plasmid #12177; Backbone Size:3745; Vector Backbone:pIS2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33208 Copy
Species: Homo sapiens
Genetic Insert: MAP4K4 3'UTR
Vector Backbone Description: Backbone Marker:Addgene plasmid #12177; Backbone Size:3745; Vector Backbone:pIS2; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33207 Copy
Species: Drosophila melanogaster
Genetic Insert: Cyc
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His A; Vector Types:Insect Expression, Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33156 Copy
Species:
Genetic Insert:
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His B; Vector Types:Insect Expression, Luciferase; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33154 Copy
Species: Caenorhabditis elegans
Genetic Insert: cog-1 3'UTR
Vector Backbone Description: Backbone Marker:Addgene (#12179); Backbone Size:4085; Vector Backbone:pIS1; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33159 Copy
Species: Mus musculus
Genetic Insert: GLIS1, Gateway casette A
Vector Backbone Description: Backbone Marker:Dr. Toshio Kitamura; Backbone Size:4700; Vector Backbone:pMXs; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33273 Copy
Species: Drosophila melanogaster
Genetic Insert: CLK
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pAc5.1/V5-His B; Vector Types:Insect Expression, Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33153 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: RP51A-synthetic minimal intron
Vector Backbone Description: Vector Backbone:pLGSD5; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments: Original intron sequence: GTATGTTAATATGGTTAACGTCGACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG
Proper citation: RRID:Addgene_33150 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: RP51A-synthetic minimal intron
Vector Backbone Description: Vector Backbone:pLGSD5; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
References:
Comments: Original intron sequence: GTATGTTAATATGGTTAACGTCGACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG
Modified intron sequence: GACCGTGTTTTTGATATCTATACTAACAGGCCTTTTAATAG
Proper citation: RRID:Addgene_33151 Copy
Species: Orthoreovirus T3D
Genetic Insert: L2
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33300 Copy
Species: Orthoreovirus T1L
Genetic Insert: L1
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33303 Copy
Species: Orthoreovirus T1L
Genetic Insert: L2
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33304 Copy
Species: Orthoreovirus T3D
Genetic Insert: S2
Vector Backbone Description: Backbone Marker:made by Yoshihiro Kawaoka; Vector Backbone:p3E5EGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33302 Copy
Species: uncultured proteobacterium EBAC31A08
Genetic Insert: Proteorhodopsin Optical Proton Sensor
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4127; Vector Backbone:pBAD TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33780 Copy
Species: firefly
Genetic Insert: Firefly Luciferase
Vector Backbone Description: Backbone Marker:David Baltimore; Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33307 Copy
Species:
Genetic Insert: HSV-TK/GFP
Vector Backbone Description: Vector Backbone:cFUGW; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33308 Copy
Species: Mus musculus
Genetic Insert: Etv3
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33374 Copy
Species: Mus musculus
Genetic Insert: Etv3
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3.1 hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33375 Copy
Species: E. coli
Genetic Insert: Improved MBP based Maltose Biosensor
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2300; Vector Backbone:pRSET-A; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: The GFP-T203V mutation decreases the fluorescence emission of the apo state and increases that of the saturated state in GCaMP2. In the context of MBP165-cpGFP.PPYF, the T203V mutation decreases the fluorescence emission of the apo state by half, whereas saturated fluorescence and affinity are unchanged, increasing ΔF/F to 6.5.
Proper citation: RRID:Addgene_33373 Copy
Species: Mus musculus
Genetic Insert: CREB
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.
Proper citation: RRID:Addgene_33371 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.