Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

739,423 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
EGFR-GFP
 
Resource Report
Resource Website
50+ mentions 		RRID:Addgene_32751 EGFR Homo sapiens Kanamycin PMID:9857032 To create the EGFR-GFP fusion (in-frame), the the full-length cDNA of EGFR including 3' and 5' untranslated regions was cloned into pEGFP-N1 as an XbaI/HindIII fragment. This is EGFR-wt. The 3' end of the EGFR cDNA including STOP codon and untranslated region was removed by PCR and digestion. The 3' primer generated a new SstII (SacII) site. Backbone Marker:Clontech; Backbone Size:4672; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2026-07-25 12:45:53 69
μ2-HA-WT
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32752 μ2 subunit of clathrin adaptor complex AP-2 Rattus norvegicus Ampicillin PMID:10228163 NB: The HA tag (YPYDVPDYALE) was inserted within the protein, between residues 236 and 237. Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:53 6
HECTD1
 
Resource Report
Resource Website 		RRID:Addgene_32860 HECTD1 Homo sapiens Kanamycin PDB: 2LC3. http://www.thesgc.org/structures/2LC3/ Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin amino acids 1879-1966 only 2026-07-25 12:45:54 0
SAFB1-pcDNA3.1
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32742 SAFB1 Homo sapiens Ampicillin PMID:12660241 Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:53 1
PP-MAPK2 (3RP9)
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32862 MAPK2 Toxoplasma gondii Kanamycin PDB: 3RP9. http://www.thesgc.org/structures/3RP9/ Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin amino acids 123-548 only, P421L 2026-07-25 12:45:54 1
SETD1A
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32868 SETD1A Homo sapiens Kanamycin PDB: 3S8S. http://www.thesgc.org/structures/3S8S/ Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-07-25 12:45:54 1
TPK1
 
Resource Report
Resource Website 		RRID:Addgene_32865 TPK1 Homo sapiens Kanamycin PDB: 3S4Y. http://www.thesgc.org/structures/3S4Y/ Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-07-25 12:45:54 0
pCAGFP
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32748 GFP Kanamycin PMID:21558267 The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP. Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin S65T 2026-07-25 12:45:53 3
TDRD5
 
Resource Report
Resource Website 		RRID:Addgene_32869 TDRD5 Homo sapiens Kanamycin PDB: 3S93. http://www.thesgc.org/structures/3S93/ Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-07-25 12:45:54 0
pT-CA-GFP-IRES-mLumin
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32749 CA-GFP Ampicillin PMID:21558267 CA-GFP sequence is GFP fused with DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C-terminus Backbone Marker:Dr. Alfred George, Vanderbilt University; Vector Backbone:pT-CD8-IRES-SCN2B; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin S65T 2026-07-25 12:45:53 1
pcDNA3-FLAG-CyclinF-ΔF
 
Resource Report
Resource Website 		RRID:Addgene_32973 CYCLIN F Homo sapiens Ampicillin PMID:20596027 This mutation impairs the binding to Skp1 and prevents the formation of a functional SCF. Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin F-box mutations: L35A and P36A 2026-07-25 12:45:55 0
pEntr-SRFflbio
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32971 SRF Homo sapiens Kanamycin PMID:21415370 Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin 2026-07-25 12:45:55 1
pLVX-TIGHT-CYCLINF-Tet-OFF
 
Resource Report
Resource Website 		RRID:Addgene_32977 CYCLIN F Homo sapiens Ampicillin Backbone vector, pLVX-Tight-Puro map is attached. Backbone Marker:Clontech; Backbone Size:7791; Vector Backbone:pLVX-Tight-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2026-07-25 12:45:55 0
pBABE-2XFLAG,2XHA-CyclinF-puro
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32976 CYCLIN F Homo sapiens Ampicillin PMID:20596027 Backbone Marker:Weinberg Lab; Backbone Size:5200; Vector Backbone:pBABE-puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin 2026-07-25 12:45:55 1
p3XFlag-CMV10-Flag-mMcl-1 KR
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32979 Mcl-1 Mus musculus Ampicillin PMID:20385764 Backbone Marker:Sigma; Backbone Size:6307; Vector Backbone:p3XFlag-CMV10; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin All lys changed to Arg 2026-07-25 12:45:55 3
pCGN-MEF2D
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_32963 MEF2D Mus musculus Ampicillin Backbone Marker:M. Tanaka; Backbone Size:7500; Vector Backbone:pCGN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin E287G 2026-07-25 12:45:55 1
p3XFlag-LZIP
 
Resource Report
Resource Website 		RRID:Addgene_32960 LZIP Homo sapiens Ampicillin Backbone Marker:Sigma; Backbone Size:4700; Vector Backbone:p3XFlag-CMV-7.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:55 0
pCS2-hSeparase-wt
 
Resource Report
Resource Website 		RRID:Addgene_33016 Separase Homo sapiens Ampicillin PMID:11747808 Backbone Marker:RZPD; Backbone Size:4100; Vector Backbone:pCS2+; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:55 0
3XMEF2-luc
 
Resource Report
Resource Website
10+ mentions 		RRID:Addgene_32967 MEF2 binding sites Homo sapiens Ampicillin This plasmid was cloned from pFOS WT-GL3 (Addgene #11983), where the human c-fos promoter was removed and replaced with 4 MEF2 sites. See author's map for restriction site/MCS details. Backbone Marker:Promega; Backbone Size:5000; Vector Backbone:pGL3-promoter modified; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin 2026-07-25 12:45:55 19
pMEF2D-3XFlag
 
Resource Report
Resource Website 		RRID:Addgene_32965 MEF2D Mus musculus Ampicillin Backbone Marker:Sigma; Backbone Size:6310; Vector Backbone:p3XFlag-CMV-14; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-07-25 12:45:55 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."

Recent News Entries

Kravitz Dataset 2

Contact Us

E [email protected]

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch