Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: EGFR
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4672; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments: To create the EGFR-GFP fusion (in-frame), the the full-length cDNA of EGFR including 3' and 5' untranslated regions was cloned into pEGFP-N1 as an XbaI/HindIII fragment. This is EGFR-wt. The 3' end of the EGFR cDNA including STOP codon and untranslated region was removed by PCR and digestion. The 3' primer generated a new SstII (SacII) site.
Proper citation: RRID:Addgene_32751 Copy
Species: Rattus norvegicus
Genetic Insert: μ2 subunit of clathrin adaptor complex AP-2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: NB: The HA tag (YPYDVPDYALE) was inserted within the protein, between residues 236 and 237.
Proper citation: RRID:Addgene_32752 Copy
Species: Homo sapiens
Genetic Insert: HECTD1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: PDB: 2LC3. http://www.thesgc.org/structures/2LC3/
Proper citation: RRID:Addgene_32860 Copy
Species: Homo sapiens
Genetic Insert: SAFB1
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_32742 Copy
Species: Toxoplasma gondii
Genetic Insert: MAPK2
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096; Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: PDB: 3RP9. http://www.thesgc.org/structures/3RP9/
Proper citation: RRID:Addgene_32862 Copy
Species: Homo sapiens
Genetic Insert: SETD1A
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: PDB: 3S8S. http://www.thesgc.org/structures/3S8S/
Proper citation: RRID:Addgene_32868 Copy
Species: Homo sapiens
Genetic Insert: TPK1
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: PDB: 3S4Y. http://www.thesgc.org/structures/3S4Y/
Proper citation: RRID:Addgene_32865 Copy
Species:
Genetic Insert: GFP
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:3970; Vector Backbone:pmKate2-C; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments: The gene for dark GFP (S65T) (referred to as GFP from this point forward) was created by PCR amplifying the GFP gene using a reverse primer that also encoded the 27 amino acid quenching peptide derived from the transmembrane region of influenza M2. A sequence encoding the linker (LEVLFQGP) was then inserted between the EGFP and M2 genes using the QuikChange mutagenesis (Stratagene) approach. The newly inserted linker sequence was then mutated to encode the caspase-7 cleavage recognition site (DEVDFQGP). The final sequence of CA-GFP protein is GFP with the fusion of DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C terminus. This construct was used for expression and purification of CA-GFP.
Proper citation: RRID:Addgene_32748 Copy
Species: Homo sapiens
Genetic Insert: TDRD5
Vector Backbone Description: Backbone Marker:Structural Genomics Consortium (Addgene plasmid 26096); Backbone Size:7325; Vector Backbone:pET28-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
References:
Comments: PDB: 3S93. http://www.thesgc.org/structures/3S93/
Proper citation: RRID:Addgene_32869 Copy
Species:
Genetic Insert: CA-GFP
Vector Backbone Description: Backbone Marker:Dr. Alfred George, Vanderbilt University; Vector Backbone:pT-CD8-IRES-SCN2B; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: CA-GFP sequence is GFP fused with DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C-terminus
Proper citation: RRID:Addgene_32749 Copy
Species: Homo sapiens
Genetic Insert: CYCLIN F
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3.1(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: This mutation impairs the binding to Skp1 and prevents the formation of a functional SCF.
Proper citation: RRID:Addgene_32973 Copy
Species: Homo sapiens
Genetic Insert: SRF
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:2700; Vector Backbone:pEntr3c; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_32971 Copy
Species: Homo sapiens
Genetic Insert: CYCLIN F
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:7791; Vector Backbone:pLVX-Tight-Puro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments: Backbone vector, pLVX-Tight-Puro map is attached.
Proper citation: RRID:Addgene_32977 Copy
Species: Homo sapiens
Genetic Insert: CYCLIN F
Vector Backbone Description: Backbone Marker:Weinberg Lab; Backbone Size:5200; Vector Backbone:pBABE-puro; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_32976 Copy
Species: Mus musculus
Genetic Insert: Mcl-1
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:6307; Vector Backbone:p3XFlag-CMV10; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_32979 Copy
Species: Mus musculus
Genetic Insert: MEF2D
Vector Backbone Description: Backbone Marker:M. Tanaka; Backbone Size:7500; Vector Backbone:pCGN; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_32963 Copy
Species: Homo sapiens
Genetic Insert: LZIP
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:4700; Vector Backbone:p3XFlag-CMV-7.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_32960 Copy
Species: Homo sapiens
Genetic Insert: Separase
Vector Backbone Description: Backbone Marker:RZPD; Backbone Size:4100; Vector Backbone:pCS2+; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_33016 Copy
Species: Homo sapiens
Genetic Insert: MEF2 binding sites
Vector Backbone Description: Backbone Marker:Promega; Backbone Size:5000; Vector Backbone:pGL3-promoter modified; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
References:
Comments: This plasmid was cloned from pFOS WT-GL3 (Addgene #11983), where the human c-fos promoter was removed and replaced with 4 MEF2 sites. See author's map for restriction site/MCS details.
Proper citation: RRID:Addgene_32967 Copy
Species: Mus musculus
Genetic Insert: MEF2D
Vector Backbone Description: Backbone Marker:Sigma; Backbone Size:6310; Vector Backbone:p3XFlag-CMV-14; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_32965 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
