Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Search

Type in a keyword to search
Reset search
On page 99 showing 1961 ~ 1980 out of 55,391 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079638

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PLXNB2

Proper citation: Atlas Antibodies Cat# HPA003100, RRID:AB_1079638 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2185280

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SERINC4

Proper citation: Atlas Antibodies Cat# HPA018526, RRID:AB_2185280 Copy   

    • RRID:AB_577215

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_577215

Comments: Discontinued; Applications: WB (1:2,000-1:10,000), IHC (1:200-1:1,000), IP (2-5 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): SUPT6H

Proper citation: Thermo Fisher Scientific Cat# A300-801A, RRID:AB_577215 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10960385

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): THAP11 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041434, RRID:AB_10960385 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1158146

Comments: Used By NYUIHC-1057
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND

Proper citation: Cell Marque Cat# 120M-85, RRID:AB_1158146 Copy   

    • RRID:AB_355500

    This resource has 10+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_355500

Comments: Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Neutralization, CyTOF-ready
Host Organism: Goat
Clonality polyclonal
Target(s): VEGFR2/KDR/Flk-1

Proper citation: R and D Systems Cat# AF644, RRID:AB_355500 Copy   

    • RRID:AB_2058564

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2058564

Comments: Applications: Western Blot, Immunohistochemistry
Host Organism: Goat
Clonality polyclonal
Target(s): Artemin

Proper citation: R and D Systems Cat# AF2589, RRID:AB_2058564 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857415

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPAST

Proper citation: Atlas Antibodies Cat# HPA017311, RRID:AB_1857415 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854123

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): MRPS22 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA007830, RRID:AB_1854123 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795006

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): MTHFSD antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041333, RRID:AB_10795006 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10959602

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): C17orf39 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044348, RRID:AB_10959602 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844459

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ABTB2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA020065, RRID:AB_1844459 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846615

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CHADL

Proper citation: Atlas Antibodies Cat# HPA024654, RRID:AB_1846615 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2631039

Comments: Info: Used by Czech Centre for Phenogenomics
Host Organism: rat
Clonality monoclonal
Target(s): CD31

Proper citation: Dianova Cat# DIA-310, RRID:AB_2631039 Copy   

    • RRID:AB_2685618

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685618

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HADHB

Proper citation: Atlas Antibodies Cat# HPA066099, RRID:AB_2685618 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10673354

Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CENPH antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA036494, RRID:AB_10673354 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675338

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OXNAD1

Proper citation: Atlas Antibodies Cat# HPA036830, RRID:AB_2675338 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859335

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ZNF48

Proper citation: Sigma-Aldrich Cat# HPA023806, RRID:AB_1859335 Copy   

    • RRID:AB_2680177

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680177

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WASHC2A

Proper citation: Atlas Antibodies Cat# HPA047844, RRID:AB_2680177 Copy   

    • RRID:AB_2336030

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2336030

Comments: Used By NYUIHC-24
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND

Proper citation: Innovative Research Cat# 18-0220, RRID:AB_2336030 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within kravitz2 that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."

Recent News Entries

Kravitz Dataset 2

Contact Us

E [email protected]

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch