Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Search

Type in a keyword to search
Reset search
On page 97 showing 1921 ~ 1940 out of 55,391 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079289

Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunofluorescence; Immunohistochemistry; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): ANTI-PLIN3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA006427, RRID:AB_1079289 Copy   

    • RRID:AB_2159706

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2159706

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): Pax-6 (H-295)

Proper citation: Santa Cruz Biotechnology Cat# sc-11357, RRID:AB_2159706 Copy   

    • RRID:AB_2889189

    This resource has 10+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2889189

Comments:
Host Organism:
Clonality monoclonal
Target(s): CD3

Proper citation: Abcam Cat# ab11089, RRID:AB_2889189 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849931

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human GPLD1

Proper citation: Sigma-Aldrich Cat# HPA012500, RRID:AB_1849931 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844820

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ANGPT1

Proper citation: Sigma-Aldrich Cat# HPA018793, RRID:AB_1844820 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601966

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): AF130358.1 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA027071, RRID:AB_10601966 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602106

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): ADARB1 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA029645, RRID:AB_10602106 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078363

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): C9orf46

Proper citation: Sigma-Aldrich Cat# HPA008214, RRID:AB_1078363 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601861

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIM8

Proper citation: Atlas Antibodies Cat# HPA023561, RRID:AB_10601861 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601154

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RABL3

Proper citation: Atlas Antibodies Cat# HPA035151, RRID:AB_10601154 Copy   

    • RRID:AB_2675568

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675568

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): ENKUR

Proper citation: Sigma-Aldrich Cat# HPA037594, RRID:AB_2675568 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10603237

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEP; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): S1PR5

Proper citation: Atlas Antibodies Cat# HPA029683, RRID:AB_10603237 Copy   

    • RRID:AB_2615917

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2615917

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20141229.LRH.LAS for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): ZNF783

Proper citation: CDI Cat# R1257.1.2A8, RRID:AB_2615917 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681110

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COL13A1

Proper citation: Atlas Antibodies Cat# HPA050392, RRID:AB_2681110 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679590

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): RASGRP1

Proper citation: Atlas Antibodies Cat# HPA046216, RRID:AB_2679590 Copy   

    • RRID:AB_1846524

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846524

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CENPP

Proper citation: Atlas Antibodies Cat# HPA021787, RRID:AB_1846524 Copy   

    • RRID:AB_10600812

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600812

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SORBS1

Proper citation: Atlas Antibodies Cat# HPA027559, RRID:AB_10600812 Copy   

    • RRID:AB_2616446

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2616446

Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): hda-1

Proper citation: SDIX Cat# 2217.00.02, RRID:AB_2616446 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684677

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM167B

Proper citation: Atlas Antibodies Cat# HPA062074, RRID:AB_2684677 Copy   

    • RRID:AB_2675362

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675362

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RIF1

Proper citation: Atlas Antibodies Cat# HPA036888, RRID:AB_2675362 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within kravitz2 that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."

Recent News Entries

Kravitz Dataset 2

Contact Us

E [email protected]

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch