Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PCDHB10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029441, RRID:AB_10601980 PCDHB10 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FAQALYETQAPENSPIGFLIVKVWAEDVDSGVNAEVSYSFFDASENIRTTFQINPFSGEIFLRELLDYELVNSYKINIQAMDGGGLSARCRVLVEVLDTNDNPPELIVSSFSNSVAENSPETPLAVFKINDRDSGENG; Manufacturer approved use: IHC polyclonal rabbit AB_10601980 Atlas Antibodies HPA029441 2025-08-20 12:19:05 0
Anti-SNW1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA002457, RRID:AB_1080047 SNW1 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1080047 Atlas Antibodies HPA002457 2025-08-20 12:19:05 0
NOP2-human
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX105945, RRID:AB_2616092 NOP2 human ENCODE PROJECT External validation DATA SET is released testing lot 40954 for not specified; status is not pursued polyclonal rabbit AB_2616092 GeneTex GTX105945 (also ENCAB712HQO) 2025-08-20 12:18:58 0
Anti-SETD6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041481, RRID:AB_10804004 SETD6 human Originating manufacturer of this product. Applications: WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10804004 Atlas Antibodies HPA041481 2025-08-20 12:18:58 0
Anti-MYOM3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029752, RRID:AB_10601443 MYOM3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601443 Atlas Antibodies HPA029752 2025-08-20 12:18:58 0
Anti-SEMA3E polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA063804, RRID:AB_2685127 SEMA3E human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685127 Atlas Antibodies HPA063804 2025-08-20 12:18:59 1
Anti-TMEM198 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042385, RRID:AB_2677972 TMEM198 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677972 Atlas Antibodies HPA042385 2025-08-20 12:19:06 0
Anti-ZNF507 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049728, RRID:AB_2680864 ZNF507 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680864 Atlas Antibodies HPA049728 2025-08-20 12:19:06 0
Anti-MYO15A Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA078501, RRID:AB_2732383 MYO15A human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732383 Atlas Antibodies HPA078501 2025-08-20 12:19:10 0
Anti-RTKN2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038446, RRID:AB_10796218 RTKN2 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10796218 Atlas Antibodies HPA038446 2025-08-20 12:18:58 0
Anti-TNKS1BP1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037929, RRID:AB_10672613 TNKS1BP1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672613 Atlas Antibodies HPA037929 2025-08-20 12:19:05 0
Anti-DNM1L polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA039324, RRID:AB_2676443 DNM1L human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676443 Atlas Antibodies HPA039324 2025-08-20 12:19:05 1
Anti-SPATA21 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA032079, RRID:AB_10670706 SPATA21 antibody produced in rabbit human polyclonal rabbit AB_10670706 Atlas Antibodies HPA032079 2025-08-20 12:19:01 0
Anti-BTNL2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039844, RRID:AB_10805596 BTNL2 antibody produced in rabbit human polyclonal rabbit AB_10805596 Atlas Antibodies HPA039844 2025-08-20 12:19:14 0
Anti-OGG1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA027514, RRID:AB_10602189 OGG1 antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_10602189 Sigma-Aldrich HPA027514 2025-08-20 12:19:19 0
Anti-SLC30A1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA015275, RRID:AB_1857083 SLC30A1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_1857083 Sigma-Aldrich HPA015275 2025-08-20 12:19:16 0
Anti-PGAP3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA016591, RRID:AB_1855203 PGAP3 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_1855203 Sigma-Aldrich HPA016591 2025-08-20 12:19:50 0
POLE3-human
 
Resource Report
Resource Website
Rating or validation data
CDI Cat# JH99.1.3A4, RRID:AB_2615951 POLE3 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 20140826.DNF for not specified; status is not pursued unknown mouse AB_2615951 CDI JH99.1.3A4 (also ENCAB837IYB) 2025-08-20 12:08:02 0
Anti-NCOA7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030292, RRID:AB_10670834 NCOA7 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670834 Atlas Antibodies HPA030292 2025-08-20 12:07:27 0
Anti-DHX32 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048872, RRID:AB_2680540 DHX32 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680540 Atlas Antibodies HPA048872 2025-08-20 12:08:06 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.