Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Search

Type in a keyword to search
Reset search
On page 92 showing 1821 ~ 1840 out of 55,391 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601980

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FAQALYETQAPENSPIGFLIVKVWAEDVDSGVNAEVSYSFFDASENIRTTFQINPFSGEIFLRELLDYELVNSYKINIQAMDGGGLSARCRVLVEVLDTNDNPPELIVSSFSNSVAENSPETPLAVFKINDRDSGENG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): PCDHB10

Proper citation: Atlas Antibodies Cat# HPA029441, RRID:AB_10601980 Copy   

    • RRID:AB_1080047

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080047

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SNW1

Proper citation: Atlas Antibodies Cat# HPA002457, RRID:AB_1080047 Copy   

    • RRID:AB_2616092

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2616092

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40954 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): NOP2

Proper citation: GeneTex Cat# GTX105945, RRID:AB_2616092 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10804004

Comments: Originating manufacturer of this product. Applications: WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SETD6

Proper citation: Atlas Antibodies Cat# HPA041481, RRID:AB_10804004 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601443

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MYOM3

Proper citation: Atlas Antibodies Cat# HPA029752, RRID:AB_10601443 Copy   

    • RRID:AB_2685127

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685127

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SEMA3E

Proper citation: Atlas Antibodies Cat# HPA063804, RRID:AB_2685127 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677972

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM198

Proper citation: Atlas Antibodies Cat# HPA042385, RRID:AB_2677972 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680864

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF507

Proper citation: Atlas Antibodies Cat# HPA049728, RRID:AB_2680864 Copy   

    • RRID:AB_2732383

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2732383

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MYO15A

Proper citation: Atlas Antibodies Cat# HPA078501, RRID:AB_2732383 Copy   

    • RRID:AB_10796218

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796218

Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RTKN2

Proper citation: Atlas Antibodies Cat# HPA038446, RRID:AB_10796218 Copy   

    • RRID:AB_10672613

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672613

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TNKS1BP1

Proper citation: Atlas Antibodies Cat# HPA037929, RRID:AB_10672613 Copy   

    • RRID:AB_2676443

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2676443

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DNM1L

Proper citation: Atlas Antibodies Cat# HPA039324, RRID:AB_2676443 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670706

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): SPATA21 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA032079, RRID:AB_10670706 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10805596

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): BTNL2 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA039844, RRID:AB_10805596 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602189

Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): OGG1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA027514, RRID:AB_10602189 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857083

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC30A1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA015275, RRID:AB_1857083 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855203

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): PGAP3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA016591, RRID:AB_1855203 Copy   

    • RRID:AB_2615951

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2615951

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20140826.DNF for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): POLE3

Proper citation: CDI Cat# JH99.1.3A4, RRID:AB_2615951 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670834

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NCOA7

Proper citation: Atlas Antibodies Cat# HPA030292, RRID:AB_10670834 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680540

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DHX32

Proper citation: Atlas Antibodies Cat# HPA048872, RRID:AB_2680540 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within kravitz2 that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."

Recent News Entries

Kravitz Dataset 2

Contact Us

E [email protected]

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch