Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685068
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): SLC25A24
Proper citation: Sigma-Aldrich Cat# HPA063636, RRID:AB_2685068 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686154
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MTERF1
Proper citation: Atlas Antibodies Cat# HPA069560, RRID:AB_2686154 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680194
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRKCG
Proper citation: Atlas Antibodies Cat# HPA047870, RRID:AB_2680194 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673813
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TBXAS1
Proper citation: Atlas Antibodies Cat# HPA031258, RRID:AB_2673813 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601132
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MAP4K3
Proper citation: Atlas Antibodies Cat# HPA030380, RRID:AB_10601132 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679973
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PIEZO1
Proper citation: Atlas Antibodies Cat# HPA047185, RRID:AB_2679973 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858993
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZDHHC13
Proper citation: Atlas Antibodies Cat# HPA016759, RRID:AB_1858993 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686517
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RVEDEPRAFSPEHGPAKQNGQKSRTNKMPPHPLAYTSTTNFKGWDPNEQSLRRQAYSNKGKLGTAETGSSDPLGTRPQHYPPPQPYFITNIKTEVT; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): SHISA9
Proper citation: Atlas Antibodies Cat# HPA072399, RRID:AB_2686517 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602091
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DIRAS3
Proper citation: Atlas Antibodies Cat# HPA028557, RRID:AB_10602091 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685196
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CASC10
Proper citation: Atlas Antibodies Cat# HPA064131, RRID:AB_2685196 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672767
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CLPB
Proper citation: Atlas Antibodies Cat# HPA039006, RRID:AB_10672767 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667341
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FRMD8
Proper citation: Atlas Antibodies Cat# HPA005506, RRID:AB_2667341 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681788
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KMT5C
Proper citation: Atlas Antibodies Cat# HPA052294, RRID:AB_2681788 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849147
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FRMD4B
Proper citation: Atlas Antibodies Cat# HPA009705, RRID:AB_1849147 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675170
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HOMER1
Proper citation: Atlas Antibodies Cat# HPA036521, RRID:AB_2675170 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681152
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC17A1
Proper citation: Atlas Antibodies Cat# HPA050513, RRID:AB_2681152 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859410
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF677
Proper citation: Atlas Antibodies Cat# HPA024796, RRID:AB_1859410 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10696646
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MED31
Proper citation: Atlas Antibodies Cat# HPA035947, RRID:AB_10696646 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669787
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HOMEZ
Proper citation: Atlas Antibodies Cat# HPA036317, RRID:AB_10669787 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080577
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): VPREB3
Proper citation: Atlas Antibodies Cat# HPA003041, RRID:AB_1080577 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
