Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686497
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): PAK4
Proper citation: Sigma-Aldrich Cat# HPA072220, RRID:AB_2686497 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611679
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): ASB5 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA028870, RRID:AB_10611679 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732280
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PTOV1
Proper citation: Atlas Antibodies Cat# HPA075125, RRID:AB_2732280 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_842530
Comments: manufacturer recommendations: IgG WB, IHC; ELISA; Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615136, AB_842530.
Host Organism: rabbit
Clonality polyclonal
Target(s): SFRS10 (splicing factor arginine/serine-rich 10 (transformer 2 homolog Drosophila)) (against the middle region of SFRS10) (100ug)
Proper citation: Aviva Systems Biology Cat# ARP40529_T100, RRID:AB_842530 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1140040
Comments: Applications: Immunoprecipitation; Immunofluorescence; Immunohistochemistry; Flow Cytometry; Western Blot; Immunocytochemistry; Immunohistochemistry - fixed; Flow Cyt, ICC/IF, IHC-FoFr, IHC-Fr, IHC-P, IHC-R, IP, RIA, WB; Immunohistochemistry - frozen; Radioimmunoassay
Info: Used by Czech Centre for Phenogenomics
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rat
Clonality monoclonal
Target(s): F4/80 antibody [CI:A3-1]
Proper citation: Abcam Cat# ab6640, RRID:AB_1140040 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680333
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PDCL2
Proper citation: Atlas Antibodies Cat# HPA048260, RRID:AB_2680333 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682108
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MGST3
Proper citation: Atlas Antibodies Cat# HPA053311, RRID:AB_2682108 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680932
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TFTYLTTSFPGSMNHGRFASVF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): OR8B4
Proper citation: Atlas Antibodies Cat# HPA049884, RRID:AB_2680932 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600093
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SEPT7
Proper citation: Atlas Antibodies Cat# HPA023309, RRID:AB_10600093 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678721
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM170B
Proper citation: Atlas Antibodies Cat# HPA043899, RRID:AB_2678721 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679280
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SMN1
Proper citation: Atlas Antibodies Cat# HPA045271, RRID:AB_2679280 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685241
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): BLMH
Proper citation: Sigma-Aldrich Cat# HPA064307, RRID:AB_2685241 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681466
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): MPZL2
Proper citation: Atlas Antibodies Cat# HPA051395, RRID:AB_2681466 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677185
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LARS
Proper citation: Atlas Antibodies Cat# HPA040881, RRID:AB_2677185 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678828
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCNH
Proper citation: Atlas Antibodies Cat# HPA044138, RRID:AB_2678828 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681941
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HHIPL1
Proper citation: Atlas Antibodies Cat# HPA052767, RRID:AB_2681941 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856587
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DSE
Proper citation: Atlas Antibodies Cat# HPA014764, RRID:AB_1856587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682459
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR3
Proper citation: Atlas Antibodies Cat# HPA054354, RRID:AB_2682459 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670736
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZBTB5
Proper citation: Atlas Antibodies Cat# HPA021521, RRID:AB_2670736 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680889
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NPTX2
Proper citation: Atlas Antibodies Cat# HPA049799, RRID:AB_2680889 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
