Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Rabbit Anti-CD282 / TLR2 Antibody, Unconjugated Resource Report Resource Website |
Acris Antibodies Cat# AP09340PU-N, RRID:AB_2035301 | CD282 / TLR2 | mouse, human | manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; ELISA, Paraffin sections, Western Blot | unknown | rabbit | AB_2035301 | Acris Antibodies | AP09340PU-N | 2025-08-19 10:31:55 | 0 | ||
|
Anti-CFAP77 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 | CFAP77 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10601126 | Atlas Antibodies | HPA024647 | 2025-08-19 10:32:11 | 0 | ||
|
Rabbit Anti-ErbB-2 (Her-2), phospho (Tyr1248) Polyclonal Antibody, Unconjugated Resource Report Resource Website |
AnaSpec; EGT Group Cat# 29607-025, RRID:AB_1091590 | ErbB-2 (Her-2), phospho (Tyr1248) | mouse, human | manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; Immunohistochemistry, Western Blot, ELISA | polyclonal | rabbit | AB_1091590 | AnaSpec; EGT Group | 29607-025 | 2025-08-19 10:31:50 | 0 | ||
|
Anti-CMC2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 | CMC2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845581 | Atlas Antibodies | HPA006871 | 2025-08-19 10:32:11 | 0 | ||
|
CD45RC Resource Report Resource Website |
BD Biosciences Cat# 746515, RRID:AB_2743812 | CD45RC | mouse | DNL-1.9 | Applications: Flow cytometry | monoclonal | rat | AB_2743812 | BD Biosciences | 746515 | 2025-08-19 10:32:13 | 0 | |
|
Anti-SLC22A17 Antibody Resource Report Resource Website |
Antibodies.com Cat# A82727, RRID:AB_2747989 | SLC22A17 | human | Applications: ELISA, IHC | unknown | goat | AB_2747989 | Antibodies.com | A82727 | 2025-08-19 10:32:16 | 0 | ||
|
MOB4 Polyclonal Antibody Resource Report Resource Website |
ABclonal Cat# A4590, RRID:AB_2765772 | MOB4 | rat, mouse, human | Applications:WB | polyclonal | rabbit | AB_2765772 | ABclonal | A4590 | 2025-08-19 10:32:19 | 0 | ||
|
Rabbit Anti-Human Human IgE Polyclonal, Unconjugated Resource Report Resource Website |
LSBio (LifeSpan) Cat# LS-C68500-250, RRID:AB_1652990 | Human Human IgE | human | vendor suggested use: Immunohistochemistry; Immunohistochemistry (Parrafin) | polyclonal | rabbit | AB_1652990 | LSBio (LifeSpan) | LS-C68500-250 | 2025-08-19 10:31:51 | 0 | ||
|
Anti-PRKDC / DNA-PKcs Resource Report Resource Website |
LSBio (LifeSpan) Cat# LS-C88130-100, RRID:AB_1807050 | PRKDC / DNA-PKcs | rat, human | vendor suggested use: IgG1; IgG1 IF, IHC-P (1:50 - 1:100), IP (1:50 - 1:100, 1 - 2 µg/ml), WB (1:50 - 1:100, 1 - 2 µg/ml); Western Blot; Immunohistochemistry - fixed; Immunofluorescence; Immunohistochemistry; Immunoprecipitation | monoclonal | mouse | AB_1807050 | LSBio (LifeSpan) | LS-C88130-100 | 2025-08-19 10:32:19 | 0 | ||
|
DECR2 Antibody Resource Report Resource Website |
Novus Cat# H00026063-B01P, RRID:AB_2091416 | DECR2 | Human, Rat | Applications: Western Blot | polyclonal | Mouse | AB_2091416 | Novus | H00026063-B01P | 2025-08-19 10:32:10 | 0 | ||
|
Cytokeratin 6 (A-12) Resource Report Resource Website Discontinued |
Santa Cruz Biotechnology Cat# sc-22479, RRID:AB_2249760 | Cytokeratin 6 (A-12) | rat, mouse, rabbit, human | Discontinued: 2016; validation status unknown check with seller; recommendations: Immunofluorescence; ELISA; Immunocytochemistry; WB, IF, ELISA; Western Blot | polyclonal | goat | AB_2249760 | Santa Cruz Biotechnology | sc-22479 | 2025-08-19 10:32:09 | 0 | ||
|
Mouse Anti-NHLH1 Purified - MaxPab Polyclonal Antibody, Unconjugated Resource Report Resource Website |
Abnova Cat# H00004807-B01P, RRID:AB_1677902 | NHLH1 | manufacturer recommendations: Other; Western Blot; Detection Antibody, Western Blot (Transfected Lysate) | polyclonal | mouse | AB_1677902 | Abnova | H00004807-B01P | 2025-08-19 10:31:54 | 0 | |||
|
ZNF300 Antibody Resource Report Resource Website |
Abbiotec Cat# 250541, RRID:AB_2304710 | ZNF300 | rat, h, m, mouse, r, human | manufacturer recommendations: IgG Immunohistochemistry; Western Blot; ELISA; E, WB, IHC | polyclonal | rabbit | AB_2304710 | Abbiotec | 250541 | 2025-08-19 10:31:52 | 0 | ||
|
HLA-DRB5 MaxPab mouse polyclonal antibody (B02) Resource Report Resource Website |
Abnova Cat# H00003127-B02, RRID:AB_1204479 | HLA-DRB5 MaxPab mouse polyclonal antibody (B02) | human | manufacturer recommendations: Det Ab,WB-Tr; Western Blot | polyclonal | mouse | AB_1204479 | Abnova | H00003127-B02 | 2025-08-19 10:31:55 | 0 | ||
|
Id1 (N-16) Resource Report Resource Website Discontinued |
Santa Cruz Biotechnology Cat# sc-27186, RRID:AB_648727 | Id1 (N-16) | rat, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: Western Blot; Immunofluorescence; ELISA; WB, IF, ELISA | polyclonal | goat | AB_648727 | Santa Cruz Biotechnology | sc-27186 | 2025-08-19 10:32:10 | 0 | ||
|
XCL1 antibody Resource Report Resource Website |
Biorbyt Cat# orb20377, RRID:AB_10751666 | XCL1 antibody | human | manufacturer recommendations: IgG ELISA; ELISA | polyclonal | goat | AB_10751666 | Biorbyt | orb20377 | 2025-08-19 10:32:19 | 0 | ||
|
Rabbit Anti-Mouse Focal Adhesion Kinase 1 (PTK2, FAK1) Polyclonal, Unconjugated Resource Report Resource Website |
LSBio (LifeSpan) Cat# LS-C41215-50, RRID:AB_1192027 | Mouse Focal Adhesion Kinase 1 (PTK2, FAK1) | mouse, human | vendor suggested use: Western Blot; Western Blot | polyclonal | rabbit | AB_1192027 | LSBio (LifeSpan) | LS-C41215-50 | 2025-08-19 10:32:11 | 0 | ||
|
Rabbit Anti-Gclc Polyclonal Antibody Resource Report Resource Website Discontinued |
Creative Biomart Cat# DPABT-H10262, RRID:AB_11393058 | Gclc | human | Discontinued: 2015; Discontinued on 27 July 2015; IHC-P | polyclonal | rabbit | AB_11393058 | Creative Biomart | DPABT-H10262 | 2025-08-19 10:32:14 | 0 | ||
|
Mouse Anti-C18orf15 Polyclonal Antibody, Unconjugated Resource Report Resource Website |
Primm Biotech Cat# Ab-1478-YOM, RRID:AB_10804855 | Mouse C18orf15 | functionality unknown, check validation data for this product with vendor | polyclonal | mouse | AB_10804855 | Primm Biotech | Ab-1478-YOM | 2025-08-19 10:32:12 | 0 | |||
|
FOS antibody Resource Report Resource Website |
Biorbyt Cat# orb10666, RRID:AB_10767713 | FOS antibody | rat, mouse, human | manufacturer recommendations: IgG ELISA, WB; Western Blot; ELISA | polyclonal | rabbit | AB_10767713 | Biorbyt | orb10666 | 2025-08-19 10:32:15 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.