Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-SLC27A3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006935, RRID:AB_1080003 SLC27A3 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1080003 Atlas Antibodies HPA006935 2025-08-19 10:58:20 0
Anti-EXOC7 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA022840, RRID:AB_1848316 Human EXOC7 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1848316 Sigma-Aldrich HPA022840 2025-08-19 10:58:52 0
Anti-DGCR2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA000873, RRID:AB_1847632 Human DGCR2 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1847632 Sigma-Aldrich HPA000873 2025-08-19 10:58:51 0
Anti-HLX antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA005968, RRID:AB_1079066 Human HLX1 human Vendor recommendations: unknown rabbit AB_1079066 Sigma-Aldrich HPA005968 2025-08-19 10:59:13 1
Phospho-FAK (Tyr397) (D20B1) Rabbit mAb
 
Resource Report
Resource Website
50+ mentions
Rating or validation data
Cell Signaling Technology Cat# 8556, RRID:AB_10891442 Phospho-FAK (Tyr397) (D20B1) Rabbit mAb rat, h, m, mouse, r, human, mk Applications: W, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal rabbit AB_10891442 Cell Signaling Technology 8556 2025-08-19 10:58:30 53
FOXM1-human
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX102170, RRID:AB_10720162 FOXM1 human ENCODE PROJECT External validation DATA SET is released testing lot 40373 for K562,MCF-7,HEK293T; status is awaiting lab characterization,pending dcc review polyclonal rabbit AB_10720162 GeneTex GTX102170 2025-08-19 10:59:02 0
Anti-Histone H3.3 Antibody, K27M mutant
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Millipore Cat# ABE419, RRID:AB_2728728 Histone H3.3, K27M mutant mouse, human for use in western blotting (WB) & Chromatin immunoprecipitation (ChIP). original provider is Merck
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
polyclonal rabbit AB_2728728 Millipore ABE419 2025-08-19 10:59:21 14
Anti-CCDC28A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055125, RRID:AB_2682705 CCDC28A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682705 Atlas Antibodies HPA055125 2025-08-19 10:59:19 0
Anti-HRH4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035009, RRID:AB_10671507 HRH4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQRE; Manufacturer approved use: IHC polyclonal rabbit AB_10671507 Atlas Antibodies HPA035009 2025-08-19 10:59:16 0
Anti-LMNTD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045911, RRID:AB_10962977 LMNTD1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10962977 Atlas Antibodies HPA045911 2025-08-19 10:58:34 0
Anti-SERPINE3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055804, RRID:AB_2682928 SERPINE3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682928 Atlas Antibodies HPA055804 2025-08-19 10:58:34 0
Anti-ICE1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054452, RRID:AB_2682492 ICE1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682492 Atlas Antibodies HPA054452 2025-08-19 10:58:34 0
Anti-ALDH9A1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA010873, RRID:AB_1078126 ALDH9A1 antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot polyclonal rabbit AB_1078126 Sigma-Aldrich HPA010873 2025-08-19 10:59:35 0
Anti-THOC3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA045071, RRID:AB_10959461 THOC3 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10959461 Sigma-Aldrich HPA045071 2025-08-19 10:58:53 0
Anti-ABHD1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA044390, RRID:AB_10959380 ABHD1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10959380 Sigma-Aldrich HPA044390 2025-08-19 10:59:39 0
Anti-CLIP4 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043366, RRID:AB_10963051 CLIP4 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10963051 Sigma-Aldrich HPA043366 2025-08-19 10:58:55 0
Anti-CLCN7 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043586, RRID:AB_10965322 CLCN7 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10965322 Sigma-Aldrich HPA043586 2025-08-19 10:58:54 0
Anti-COBRA1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA020259, RRID:AB_1847072 Human COBRA1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1847072 Sigma-Aldrich HPA020259 2025-08-19 10:58:58 0
Anti-C17orf67 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043479, RRID:AB_10964083 C17orf67 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10964083 Sigma-Aldrich HPA043479 2025-08-19 10:59:39 0
Laminin-R (MLuC5)
 
Resource Report
Resource Website
Rating or validation data
Santa Cruz Biotechnology Cat# sc-59732, RRID:AB_784274 Laminin-R (MLuC5) rat, human validation status unknown check with seller; recommendations: Immunocytochemistry; Flow Cytometry; Immunofluorescence; Immunohistochemistry; Western Blot; Immunoprecipitation; WB, IP, IF, IHC(P), FCM monoclonal mouse AB_784274 Santa Cruz Biotechnology sc-59732 2025-08-19 10:59:02 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Kravitz Dataset 2 Resources

    Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.