Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-SLC27A3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006935, RRID:AB_1080003 | SLC27A3 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1080003 | Atlas Antibodies | HPA006935 | 2025-08-19 10:58:20 | 0 | ||
|
Anti-EXOC7 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA022840, RRID:AB_1848316 | Human EXOC7 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1848316 | Sigma-Aldrich | HPA022840 | 2025-08-19 10:58:52 | 0 | ||
|
Anti-DGCR2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA000873, RRID:AB_1847632 | Human DGCR2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847632 | Sigma-Aldrich | HPA000873 | 2025-08-19 10:58:51 | 0 | ||
|
Anti-HLX antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA005968, RRID:AB_1079066 | Human HLX1 | human | Vendor recommendations: | unknown | rabbit | AB_1079066 | Sigma-Aldrich | HPA005968 | 2025-08-19 10:59:13 | 1 | ||
|
Phospho-FAK (Tyr397) (D20B1) Rabbit mAb Resource Report Resource Website 50+ mentions Rating or validation data |
Cell Signaling Technology Cat# 8556, RRID:AB_10891442 | Phospho-FAK (Tyr397) (D20B1) Rabbit mAb | rat, h, m, mouse, r, human, mk |
Applications: W, IP Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | rabbit | AB_10891442 | Cell Signaling Technology | 8556 | 2025-08-19 10:58:30 | 53 | ||
|
FOXM1-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX102170, RRID:AB_10720162 | FOXM1 | human | ENCODE PROJECT External validation DATA SET is released testing lot 40373 for K562,MCF-7,HEK293T; status is awaiting lab characterization,pending dcc review | polyclonal | rabbit | AB_10720162 | GeneTex | GTX102170 | 2025-08-19 10:59:02 | 0 | ||
|
Anti-Histone H3.3 Antibody, K27M mutant Resource Report Resource Website 10+ mentions Rating or validation data |
Millipore Cat# ABE419, RRID:AB_2728728 | Histone H3.3, K27M mutant | mouse, human |
for use in western blotting (WB) & Chromatin immunoprecipitation (ChIP). original provider is Merck Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
polyclonal | rabbit | AB_2728728 | Millipore | ABE419 | 2025-08-19 10:59:21 | 14 | ||
|
Anti-CCDC28A polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055125, RRID:AB_2682705 | CCDC28A | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682705 | Atlas Antibodies | HPA055125 | 2025-08-19 10:59:19 | 0 | ||
|
Anti-HRH4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA035009, RRID:AB_10671507 | HRH4 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQRE; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10671507 | Atlas Antibodies | HPA035009 | 2025-08-19 10:59:16 | 0 | ||
|
Anti-LMNTD1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA045911, RRID:AB_10962977 | LMNTD1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10962977 | Atlas Antibodies | HPA045911 | 2025-08-19 10:58:34 | 0 | ||
|
Anti-SERPINE3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055804, RRID:AB_2682928 | SERPINE3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682928 | Atlas Antibodies | HPA055804 | 2025-08-19 10:58:34 | 0 | ||
|
Anti-ICE1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA054452, RRID:AB_2682492 | ICE1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682492 | Atlas Antibodies | HPA054452 | 2025-08-19 10:58:34 | 0 | ||
|
Anti-ALDH9A1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA010873, RRID:AB_1078126 | ALDH9A1 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry; Western Blot | polyclonal | rabbit | AB_1078126 | Sigma-Aldrich | HPA010873 | 2025-08-19 10:59:35 | 0 | ||
|
Anti-THOC3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045071, RRID:AB_10959461 | THOC3 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10959461 | Sigma-Aldrich | HPA045071 | 2025-08-19 10:58:53 | 0 | |||
|
Anti-ABHD1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044390, RRID:AB_10959380 | ABHD1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10959380 | Sigma-Aldrich | HPA044390 | 2025-08-19 10:59:39 | 0 | |||
|
Anti-CLIP4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043366, RRID:AB_10963051 | CLIP4 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10963051 | Sigma-Aldrich | HPA043366 | 2025-08-19 10:58:55 | 0 | |||
|
Anti-CLCN7 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043586, RRID:AB_10965322 | CLCN7 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10965322 | Sigma-Aldrich | HPA043586 | 2025-08-19 10:58:54 | 0 | |||
|
Anti-COBRA1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020259, RRID:AB_1847072 | Human COBRA1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847072 | Sigma-Aldrich | HPA020259 | 2025-08-19 10:58:58 | 0 | ||
|
Anti-C17orf67 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043479, RRID:AB_10964083 | C17orf67 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10964083 | Sigma-Aldrich | HPA043479 | 2025-08-19 10:59:39 | 0 | |||
|
Laminin-R (MLuC5) Resource Report Resource Website Rating or validation data |
Santa Cruz Biotechnology Cat# sc-59732, RRID:AB_784274 | Laminin-R (MLuC5) | rat, human | validation status unknown check with seller; recommendations: Immunocytochemistry; Flow Cytometry; Immunofluorescence; Immunohistochemistry; Western Blot; Immunoprecipitation; WB, IP, IF, IHC(P), FCM | monoclonal | mouse | AB_784274 | Santa Cruz Biotechnology | sc-59732 | 2025-08-19 10:59:02 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
