Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-BOD1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA036293, RRID:AB_10673127 | BOD1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10673127 | Sigma-Aldrich | HPA036293 | 2025-08-19 11:23:59 | 0 | ||
|
Anti-NeuN antibody [EPR12763] Resource Report Resource Website 100+ mentions Rating or validation data |
Abcam Cat# ab177487, RRID:AB_2532109 | NeuN | rat, goat, mouse, cat, marmoset, zebrafish, dog, human, sheep | EPR12763 | IHC-FoFr, Flow Cyt, IHC-Fr, IHC-P, WB, ICC/IF | monoclonal | rabbit | AB_2532109 | Abcam | ab177487 | 2025-08-19 11:22:20 | 247 | |
|
Anti-MAP4K1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA007419, RRID:AB_1853778 | MAP4K1 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1853778 | Atlas Antibodies | HPA007419 | 2025-08-19 11:21:47 | 0 | ||
|
Anti-KLHL28 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA000988, RRID:AB_1845480 | KLHL28 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845480 | Atlas Antibodies | HPA000988 | 2025-08-19 11:21:46 | 0 | ||
|
Anti-SPOCK1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA007450, RRID:AB_10603116 | SPOCK1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10603116 | Atlas Antibodies | HPA007450 | 2025-08-19 11:21:47 | 0 | ||
|
Anti-C1orf112 Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA023778, RRID:AB_1848665 | C1orf112 | human | Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1848665 | Atlas Antibodies | HPA023778 | 2025-08-19 11:21:48 | 1 | ||
|
Anti-ADCY5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA017730, RRID:AB_1844595 | ADCY5 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YLKEHSIETFLTLRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRS; Manufacturer approved use: ICC-IF, IHC | polyclonal | rabbit | AB_1844595 | Atlas Antibodies | HPA017730 | 2025-08-19 11:22:38 | 0 | ||
|
Pumilio 2 Antibody Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A300-202A, RRID:AB_2173752 | Pumilio 2 | mouse, human | Discontinued; Applications: WB (1:10,000-1:20,000), IP (5-10 µg/mg lysate) | polyclonal | rabbit | AB_2173752 | Thermo Fisher Scientific | A300-202A | 2025-08-19 11:21:52 | 5 | ||
|
Anti-KRT23 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA016959, RRID:AB_1852228 | KRT23 | human | Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1852228 | Atlas Antibodies | HPA016959 | 2025-08-19 11:21:47 | 0 | ||
|
Anti-PLXNB2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA003100, RRID:AB_1079638 | PLXNB2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1079638 | Atlas Antibodies | HPA003100 | 2025-08-19 11:21:46 | 0 | ||
|
Anti-SERINC4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA018526, RRID:AB_2185280 | SERINC4 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYS; Manufacturer approved use: IHC | polyclonal | rabbit | AB_2185280 | Atlas Antibodies | HPA018526 | 2025-08-19 11:22:38 | 0 | ||
|
SUPT6H Antibody Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A300-801A, RRID:AB_577215 | SUPT6H | mouse, human | Discontinued; Applications: WB (1:2,000-1:10,000), IHC (1:200-1:1,000), IP (2-5 µg/mg lysate) | polyclonal | rabbit | AB_577215 | Thermo Fisher Scientific | A300-801A | 2025-08-19 11:22:01 | 3 | ||
|
Anti-THAP11 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA041434, RRID:AB_10960385 | THAP11 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10960385 | Sigma-Aldrich | HPA041434 | 2025-08-19 11:22:44 | 0 | |||
|
CD 20, B-lymphocyte cell-surface antigen B1 Resource Report Resource Website 1+ mentions Rating or validation data |
Cell Marque Cat# 120M-85, RRID:AB_1158146 | ND | [L26] |
Used By NYUIHC-1057 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_1158146 | Cell Marque | 120M-85 | 2025-08-19 11:22:55 | 1 | ||
|
Anti-NCBP2L antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA010664, RRID:AB_1079451 | Human NCBP2L | human | Vendor recommendations: | unknown | rabbit | AB_1079451 | Sigma-Aldrich | HPA010664 | 2025-08-19 11:31:46 | 0 | ||
|
Anti-GLUL antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA007571, RRID:AB_1078980 | Human GLUL | human | Vendor recommendations: | unknown | rabbit | AB_1078980 | Sigma-Aldrich | HPA007571 | 2025-08-19 11:31:42 | 0 | ||
|
Anti-OGDH antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020347, RRID:AB_1854773 | OGDH antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1854773 | Sigma-Aldrich | HPA020347 | 2025-08-19 11:31:54 | 0 | ||
|
Anti-RPS6KA4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA023225, RRID:AB_1854144 | RPS6KA4 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Immunofluorescence; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1854144 | Sigma-Aldrich | HPA023225 | 2025-08-19 11:31:53 | 0 | ||
|
Anti-CDH1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA004812, RRID:AB_1078369 | CDH1 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1078369 | Sigma-Aldrich | HPA004812 | 2025-08-19 11:32:06 | 2 | ||
|
Anti-FGL2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA026682, RRID:AB_1848533 | FGL2 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_1848533 | Sigma-Aldrich | HPA026682 | 2025-08-19 11:32:17 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
