Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-NAPG antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA008208, RRID:AB_1854305 | Human NAPG | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854305 | Sigma-Aldrich | HPA008208 | 2025-08-20 12:04:29 | 0 | ||
|
Anti-ASB6 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA004341, RRID:AB_1845070 | ASB6 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845070 | Atlas Antibodies | HPA004341 | 2025-08-20 12:17:00 | 0 | ||
|
Anti-NUAK1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA027455, RRID:AB_10602013 | NUAK1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQ; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10602013 | Atlas Antibodies | HPA027455 | 2025-08-20 12:17:02 | 0 | ||
|
Anti-ACOX1 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA021195, RRID:AB_1844528 | ACOX1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1844528 | Atlas Antibodies | HPA021195 | 2025-08-20 12:17:02 | 2 | ||
|
Anti-CFAP157 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021474, RRID:AB_1845801 | CFAP157 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845801 | Atlas Antibodies | HPA021474 | 2025-08-20 12:16:13 | 0 | ||
|
Anti-LPCAT2 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA007891, RRID:AB_1845223 | LPCAT2 | rat, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845223 | Atlas Antibodies | HPA007891 | 2025-08-20 12:17:00 | 1 | ||
|
Anti-LRRC14 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021047, RRID:AB_1853298 | LRRC14 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1853298 | Atlas Antibodies | HPA021047 | 2025-08-20 12:17:02 | 0 | ||
|
Anti-TPRN polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA020899, RRID:AB_1845835 | TPRN | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845835 | Atlas Antibodies | HPA020899 | 2025-08-20 12:16:12 | 2 | ||
|
Anti-FAM159B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA011778, RRID:AB_1848382 | FAM159B | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1848382 | Atlas Antibodies | HPA011778 | 2025-08-20 12:17:01 | 0 | ||
|
p62 Resource Report Resource Website 1+ mentions Rating or validation data |
Abcam Cat# ab207305, RRID:AB_2885112 | p62 |
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4818440 |
unknown | AB_2885112 | Abcam | ab207305 | 2025-08-20 12:16:27 | 6 | ||||
|
ZNF407-human Resource Report Resource Website Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A304-180A, RRID:AB_2620377 | ZNF407 | human | Discontinued; Applications: IP (2-10 µg/mg lysate) | polyclonal | rabbit | AB_2620377 | Thermo Fisher Scientific | A304-180A (also A304-180A-T) | 2025-08-20 12:16:24 | 0 | ||
|
Anti-FAM60A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038167, RRID:AB_10675629 | FAM60A antibody produced in rabbit | human | polyclonal | rabbit | AB_10675629 | Atlas Antibodies | HPA038167 | 2025-08-20 12:16:24 | 0 | |||
|
Importin alpha 3/KPNA4 Antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Novus Cat# NBP1-31260, RRID:AB_2133841 | Importin alpha 3/KPNA4 | Human, Rat, Mouse |
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
polyclonal | Rabbit | AB_2133841 | Novus | NBP1-31260 | 2025-08-20 12:17:18 | 1 | ||
|
Anti-ANKRD2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040842, RRID:AB_10963794 | ANKRD2 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10963794 | Sigma-Aldrich | HPA040842 | 2025-08-19 11:26:00 | 0 | |||
|
ANTI-APPL1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA011138, RRID:AB_1844959 | ANTI-APPL1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Western Blot; Immunofluorescence; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1844959 | Sigma-Aldrich | HPA011138 | 2025-08-19 11:25:59 | 0 | ||
|
Anti-EFHA1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA045511, RRID:AB_10959894 | EFHA1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10959894 | Sigma-Aldrich | HPA045511 | 2025-08-19 11:25:53 | 2 | |||
|
Anti-HSPBAP1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044930, RRID:AB_10961122 | HSPBAP1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10961122 | Sigma-Aldrich | HPA044930 | 2025-08-19 11:25:52 | 0 | |||
|
Anti-ARIH1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA003295, RRID:AB_1845017 | ARIH1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1845017 | Atlas Antibodies | HPA003295 | 2025-08-19 11:25:59 | 0 | ||
|
Anti-ENPEP antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA005128, RRID:AB_1844795 | Human ENPEP | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1844795 | Sigma-Aldrich | HPA005128 | 2025-08-19 11:25:59 | 0 | ||
|
Anti-Adenovirus, clone 20/11 Resource Report Resource Website 1+ mentions Rating or validation data |
Millipore Cat# MAB8052, RRID:AB_95243 | Adenovirus clone 20/11 | h |
seller recommendations: IgG1; IgG1 Immunohistochemistry; ELISA; Flow Cytometry; Immunofluorescence; Immunocytochemistry; ELISA, FC, IF, IH, IH(P) Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_95243 | Millipore | MAB8052 | 2025-08-19 11:26:11 | 2 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
