Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845070
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ASB6
Proper citation: Atlas Antibodies Cat# HPA004341, RRID:AB_1845070 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602013
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQ; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): NUAK1
Proper citation: Atlas Antibodies Cat# HPA027455, RRID:AB_10602013 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844528
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACOX1
Proper citation: Atlas Antibodies Cat# HPA021195, RRID:AB_1844528 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845801
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CFAP157
Proper citation: Atlas Antibodies Cat# HPA021474, RRID:AB_1845801 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845223
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LPCAT2
Proper citation: Atlas Antibodies Cat# HPA007891, RRID:AB_1845223 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853298
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LRRC14
Proper citation: Atlas Antibodies Cat# HPA021047, RRID:AB_1853298 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845835
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TPRN
Proper citation: Atlas Antibodies Cat# HPA020899, RRID:AB_1845835 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848382
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM159B
Proper citation: Atlas Antibodies Cat# HPA011778, RRID:AB_1848382 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2885112
Comments:
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4818440
Host Organism:
Clonality unknown
Target(s): p62
Proper citation: Abcam Cat# ab207305, RRID:AB_2885112 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620377
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF407
Proper citation: Thermo Fisher Scientific Cat# A304-180A, RRID:AB_2620377 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10675629
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM60A antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA038167, RRID:AB_10675629 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2133841
Comments: Applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: Rabbit
Clonality polyclonal
Target(s): Importin alpha 3/KPNA4
Proper citation: Novus Cat# NBP1-31260, RRID:AB_2133841 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963794
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): ANKRD2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040842, RRID:AB_10963794 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844959
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Immunofluorescence; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ANTI-APPL1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011138, RRID:AB_1844959 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959894
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): EFHA1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045511, RRID:AB_10959894 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961122
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): HSPBAP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044930, RRID:AB_10961122 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845017
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ARIH1
Proper citation: Atlas Antibodies Cat# HPA003295, RRID:AB_1845017 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844795
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ENPEP
Proper citation: Sigma-Aldrich Cat# HPA005128, RRID:AB_1844795 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_95243
Comments: seller recommendations: IgG1; IgG1 Immunohistochemistry; ELISA; Flow Cytometry; Immunofluorescence; Immunocytochemistry; ELISA, FC, IF, IH, IH(P)
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Adenovirus clone 20/11
Proper citation: Millipore Cat# MAB8052, RRID:AB_95243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335716
Comments: Applications: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections), Western Blot
Used By NYUIHC-872. Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): IDH1 R132H
Proper citation: Dianova Cat# DIA-H09, RRID:AB_2335716 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the kravitz2 Resources search. From here you can search through a compilation of resources used by kravitz2 and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that kravitz2 has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on kravitz2 then you can log in from here to get additional features in kravitz2 such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into kravitz2 you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within kravitz2 that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
