Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/32749
Proper Citation: RRID:Addgene_32749
Insert Name: CA-GFP
Bacterial Resistance: Ampicillin
Defining Citation: PMID:21558267
Vector Backbone Description: Backbone Marker:Dr. Alfred George, Vanderbilt University; Vector Backbone:pT-CD8-IRES-SCN2B; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: CA-GFP sequence is GFP fused with DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C-terminus
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for pT-CA-GFP-IRES-mLumin.
No alerts have been found for pT-CA-GFP-IRES-mLumin.
Source: Addgene