Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/33371
Proper Citation: RRID:Addgene_33371
Insert Name: CREB
Organism: Mus musculus
Bacterial Resistance: Ampicillin
Defining Citation: PMID:9447994
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
Check
for all resource mentions.
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for CMV500 A-CREB.
No alerts have been found for CMV500 A-CREB.
Source: Addgene
Data set from Kravitz, Owen and Kretizer's 2012 paper "Optogenetic identification of striatal projection neuron subtypes during in vivo recordings."
