Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Oryza sativa
Genetic Insert: OsPQL uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MGIFSGAGAHRPSCPSAANCAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTWSANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGTTHQEVPNGIVIPVGRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGRLPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVLLDTFIILQFLYFHYRKRHVPDEPDSADKVENLYQSHHHHHH
Proper citation: RRID:Addgene_117894 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-uPIC 5'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117890 Copy
Species: Triticum aestivum
Genetic Insert: TaALMT1-upGFP 3'
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117893 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 upGFP
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH
Proper citation: RRID:Addgene_117899 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT1 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Comments: insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH
Proper citation: RRID:Addgene_117898 Copy
Species: Other
Genetic Insert: CAS9p-TagRFP
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118386 Copy
Species: Other
Genetic Insert: CAS9p
Vector Backbone Description: Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:32601420
Proper citation: RRID:Addgene_118385 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtPIN1
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117088 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtPIN2
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117089 Copy
Species: Other
Genetic Insert: MtPT4-eGFP
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117095 Copy
Species: Other
Genetic Insert: MtPT4
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117096 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtNPY1
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117090 Copy
Species: Arabidopsis thaliana
Genetic Insert: SLAC-deltaCdeltaN
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117103 Copy
Species: Arabidopsis thaliana
Genetic Insert: SLAC-deltaC
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117102 Copy
Species: Arabidopsis thaliana
Genetic Insert: SLAH3
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117105 Copy
Species: Arabidopsis thaliana
Genetic Insert: SLAC1-FL
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117100 Copy
Species: Arabidopsis thaliana
Genetic Insert: MCA2-eGFP
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Proper citation: RRID:Addgene_117098 Copy
Species: Other
Genetic Insert: pOst1-pro-af(MUT2)-E2-Crimson
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.
Proper citation: RRID:Addgene_117663 Copy
Species: Other
Genetic Insert: pre-Ost1-pro-alphaf-Btl2
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.
Proper citation: RRID:Addgene_117665 Copy
Species: Other
Genetic Insert: pre-pro-alphaf(I)-E2-Crimson
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
Defining Citation: PMID:30314480
Comments: Integration plasmid in the pAOX1 locus.
Proper citation: RRID:Addgene_117660 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the T1D Resources search. From here you can search through a compilation of resources used by T1D and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that T1D has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on T1D then you can log in from here to get additional features in T1D such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into T1D you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within T1D that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.